ARخادم المشغّلvideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesLadrones2015798 دقيقةكوميدياجريمةتاريخ الإصدار09 أكتوبر 2015بلدانDominican Republic, United States of AmericaإنتاجPantelion FilmsAlejandro Toledo comes out of his retirement from crime to help a community reclaim land stolen from them by a beautiful but ruthless businesswoman and her clan.الممثلونFernando ColungaAlejandro ToledoMiguel VaroniEmilio SanchezEduardo YáñezSantiago GuzmanJessica LindseyMiranda KilroyFrank PerozoRexCarmen BeatoJosefa RamírezCristina RodloJackie RamirezOscar TorreMiguelitoEvelyna RodríguezMaribelNashla BogaertMaria ElenaSimilar vibes20 عنوانThe TuxedoCabbie-turned-chauffeur Jimmy Tong learns there is really only one rule when you work for playboy millionaire Clark Devlin : Never touch Devlin's prized tuxedo. But when Devlin is temporarily put out of commission in an explosive accident, …فيلم★6/10The FireflyAfter her estranged brother's sudden death, young wife Lucia bonds with his fiancée through their shared grief and finds herself falling in love.فيلم★7/10RecountIn 2000, the election of the U.S. Presidential boiled down to a few precious votes in the state of Florida — and a recount that would add "hanging chad" to every American's vocabulary.فيلم★7/10StephanieAfter a mysterious global crisis, a young girl is left alone to hide from a malevolent power that stalks her home. Her parents eventually return and the struggle begins to save their daughter.فيلم★6/10To Rob a ThiefEmilio, a Colombian con man, arrives in LA with two weeks to complete his plan to rob a former colleague, Claudio Silvestrini, who's made a fortune using infomercials to peddle snake oil to Latin immigrants. Emilio's friend Alejandro, who s…فيلم★8/10Dracula II: AscensionA group of medical students discover the body of the infamous count. Soon, they find themselves in the middle of a bizarre and dangerous conflict when a shadowy figure offers them $30 million for the body so that he may harvest his blood.فيلم★6/10Willy Wonka & the Chocolate FactoryWhen eccentric candy man Willy Wonka promises a lifetime supply of sweets and a tour of his chocolate factory to five lucky kids, penniless Charlie Bucket seeks the golden ticket that will make him a winner.فيلم★7/10Warm BodiesAfter a zombie becomes involved with the girlfriend of one of his victims, their romance sets in motion a sequence of events that might transform the entire lifeless world.فيلم★7/10OppenheimerThe story of J. Robert Oppenheimer's role in the development of the atomic bomb during World War II.فيلم★8/10JokerDuring the 1980s, a failed stand-up comedian is driven insane and turns to a life of crime and chaos in Gotham City while becoming an infamous psychopathic crime figure.فيلم★8/10Titanic101-year-old Rose DeWitt Bukater tells the story of her life aboard the Titanic, 84 years later. A young Rose boards the ship with her mother and fiancé. Meanwhile, Jack Dawson and Fabrizio De Rossi win third-class tickets aboard the ship. …فيلم★8/10Once Upon a Time... in HollywoodLos Angeles, 1969. TV star Rick Dalton, a struggling actor specializing in westerns, and stuntman Cliff Booth, his best friend, try to survive in a constantly changing movie industry. Dalton is the neighbor of the young and promising actres…فيلم★7/10Shutter IslandWorld War II soldier-turned-U.S. Marshal Teddy Daniels investigates the disappearance of a patient from a hospital for the criminally insane, but his efforts are compromised by troubling visions and a mysterious doctor.فيلم★8/10Back to the FutureEighties teenager Marty McFly is accidentally sent back in time to 1955, inadvertently disrupting his parents' first meeting and attracting his mother's romantic interest. Marty must repair the damage to history by rekindling his parents' r…فيلم★8/10PKA stranger in the city asks questions no one has asked before. Known only by his initials, the man's innocent questions and childlike curiosity take him on a journey of love, laughter and letting go.فيلم★8/10American BeautyLester Burnham, a depressed suburban father in a mid-life crisis, decides to turn his hectic life around after developing an infatuation with his daughter's attractive friend.فيلم★8/10The Shawshank RedemptionImprisoned in the 1940s for the double murder of his wife and her lover, upstanding banker Andy Dufresne begins a new life at the Shawshank prison, where he puts his accounting skills to work for an amoral warden. During his long stretch in…فيلم★9/10The Truman ShowAn insurance salesman begins to suspect that his whole life is actually some sort of reality TV show.فيلم★8/10Green BookTony Lip, a bouncer in 1962, is hired to drive pianist Don Shirley on a tour through the Deep South in the days when African Americans, forced to find alternate accommodations and services due to segregation laws below the Mason-Dixon Line,…فيلم★8/10Ex MachinaCaleb, a coder at the world's largest internet company, wins a competition to spend a week at a private mountain retreat belonging to Nathan, the reclusive CEO of the company. But when Caleb arrives at the remote location he finds that he w…فيلم★8/10