BNLegion of Fire: Killer Antsপ্লেয়ার সার্ভারvideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesLegion of Fire: Killer Ants1998495 মিনিটHorrorTV Movieমুক্তির তারিখ২৪ জুন, ১৯৯৮দেশUnited States of Americaপ্রযোজনাWorld International Network (WIN)The Producers Entertainment Group Ltd.Grosso-Jacobson ProductionsWhen a hive of deadly killer ants attack a town in Alaska, a small group races to survive and to find a way to stop the ruthless ants.অভিনেতারাMitch PileggiPolice Chief Jeff CroyEric LutesDr. Jim ConradJulia CampbellLaura SillsJeremy FoleyDallen GettlingSimilar vibes20টি শিরোনামThe Human Centipede 2 (Full Sequence)Inspired by the fictional Dr. Heiter, disturbed loner Martin dreams of creating a 12-person centipede and sets out to realize his sick fantasy.মুভি★5/10SiteAfter a terrifying encounter at an abandoned government test site, a small town family man begins seeing haunting visions of a past that threatens to destroy his present.মুভি★6/10Earth Star VoyagerIn the late 21st century, planet earth's natural resources are near depletion, and problems like acid rain and limited breathable oxygen abound. In response to the environmental decline, the Earth Star Voyager is created as an experimental …মুভি★6/10The Other SideSamuel North (Nathan Mobley) escapes from Hell to find the person who murdered him, but a team of invincible bounty hunters called REAPERS are sent from the Netherworld to bring him back.মুভি★5/108½Guido Anselmi, a film director, finds himself creatively barren at the peak of his career. Urged by his doctors to rest, Anselmi heads for a luxurious resort, but a sorry group gathers—his producer, staff, actors, wife, mistress, and relati…মুভি★8/10Shutter IslandWorld War II soldier-turned-U.S. Marshal Teddy Daniels investigates the disappearance of a patient from a hospital for the criminally insane, but his efforts are compromised by troubling visions and a mysterious doctor.মুভি★8/10OppenheimerThe story of J. Robert Oppenheimer's role in the development of the atomic bomb during World War II.মুভি★8/10Pulp FictionA burger-loving hit man, his philosophical partner, a drug-addled gangster's moll and a washed-up boxer converge in this sprawling, comedic crime caper. Their adventures unfurl in three stories that ingeniously trip back and forth in time.মুভি★8/1012 Angry MenThe defense and the prosecution have rested and the jury is filing into the jury room to decide if a young Spanish-American is guilty or innocent of murdering his father. What begins as an open and shut case soon becomes a mini-drama of eac…মুভি★9/10InceptionCobb, a skilled thief who commits corporate espionage by infiltrating the subconscious of his targets is offered a chance to regain his old life as payment for a task considered to be impossible: "inception", the implantation of another per…মুভি★8/102001: A Space OdysseyHumanity finds a mysterious object buried beneath the lunar surface and sets off to find its origins with the help of HAL 9000, the world's most advanced super computer.মুভি★8/10The Godfather Part IIIIn the midst of trying to legitimize his business dealings in 1979 New York and Italy, aging mafia don, Michael Corleone seeks forgiveness for his sins while taking a young protege under his wing.মুভি★7/10Back to the FutureEighties teenager Marty McFly is accidentally sent back in time to 1955, inadvertently disrupting his parents' first meeting and attracting his mother's romantic interest. Marty must repair the damage to history by rekindling his parents' r…মুভি★8/10American BeautyLester Burnham, a depressed suburban father in a mid-life crisis, decides to turn his hectic life around after developing an infatuation with his daughter's attractive friend.মুভি★8/10BrazilLow-level bureaucrat Sam Lowry escapes the monotony of his day-to-day life through a recurring daydream of himself as a virtuous hero saving a beautiful damsel. Investigating a case that led to the wrongful arrest and eventual death of an i…মুভি★8/10Ex MachinaCaleb, a coder at the world's largest internet company, wins a competition to spend a week at a private mountain retreat belonging to Nathan, the reclusive CEO of the company. But when Caleb arrives at the remote location he finds that he w…মুভি★8/10The Breakfast ClubFive high school students from different walks of life endure a Saturday detention under a power-hungry principal. The disparate group includes rebel John, princess Claire, outcast Allison, brainy Brian and Andrew, the jock. Each has a chan…মুভি★8/10Annie HallNew York comedian Alvy Singer falls in love with the ditsy Annie Hall.মুভি★8/10VertigoA retired San Francisco detective suffering from acrophobia investigates the strange activities of an old friend's wife, all the while becoming dangerously obsessed with her.মুভি★8/10StarbuckDavid Wozniak is a perpetual adolescent who discovers that, as a sperm donor, he has fathered 533 children. He is advised that more than 100 of his offspring are trying to force the fertility clinic to reveal the true identity of "Starbuck,…মুভি★7/10