BSServer plejeravideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesLove Today20227154 minKomedijaRomantikaPremijera04. nov 2022.ZemljaIndiaProdukcijaAGS EntertainmentA young couple is made to exchange their phones for a day. What follows is a hilarious and emotional sequence of events that puts their lives in misery.Similar vibes20 naslovaThunivuA gang goes to rob a bank only to find that there's already a criminal mastermind holding it for ransom, but his identities and motives behind the heist remains mysterious. As they plan to collect the bounty and disappear without a trace, t…Film★6/10Super DeluxeAn unfaithful newly-wed wife, an estranged parent, a priest and an angry son suddenly find themselves in the most unexpected predicaments, each poised to experience their destiny, all on one fateful day.Film★8/10LudoLudo is about the butterfly effect and how, despite all the chaos and crowd of the world, all our lives are inextricably connected. From a resurfaced sex tape to a rogue suitcase of money, four wildly different stories overlap at the whims …Film★7/10FidaaTwo young people embark on a winding and rocky path to love after meeting at a wedding.Film★7/10Superboys of MalegaonThe residents of Malegaon look to Bollywood cinema for a much-needed escape from daily drudgery. Amateur filmmaker Nasir Shaikh gets inspired to make a film for the people of Malegaon, by the people of Malegaon. He bands together his ragtag…Film★8/10Checkin' It TwiceA journeyman hockey player falls for a real estate agent in a career crisis when he's traded to her hometown and moves into the cottage in her hockey-loving family's backyard.Film★7/10DadaManikandan and Sindhu, final year college students, become parents accidentally. Situations separate them, forcing Manikandan to raise his child, Adhithya, as a single parent. What follows is a beautiful tale of a father and son and their j…Film★7/10Hanu-ManIn a small village, Hanumanthu, a petty thief, finds a mysterious gem, that gives him god-like powers. Will he succeed in keeping these powers from falling into the wrong hands and save his village?Film★7/10What Men WantMagically able to hear what men are thinking, a sports agent uses her newfound ability to turn the tables on her overbearing male colleagues.Film★6/10Bullet TrainUnlucky assassin Ladybug is determined to do his job peacefully after one too many gigs gone off the rails. Fate, however, may have other plans, as Ladybug's latest mission puts him on a collision course with lethal adversaries from around …Film★7/10Hacksaw RidgeWWII American Army Medic Desmond T. Doss, who served during the Battle of Okinawa, refuses to kill people and becomes the first Conscientious Objector in American history to receive the Congressional Medal of Honor.Film★8/10Toy StoryLed by Woody, Andy's toys live happily in his room until Andy's birthday brings Buzz Lightyear onto the scene. Afraid of losing his place in Andy's heart, Woody plots against Buzz. But when circumstances separate Buzz and Woody from their o…Film★8/10Avatar: The Way of WaterSet more than a decade after the events of the first film, learn the story of the Sully family (Jake, Neytiri, and their kids), the trouble that follows them, the lengths they go to keep each other safe, the battles they fight to stay alive…Film★8/10Forrest GumpA man with a low IQ has accomplished great things in his life and been present during significant historic events—in each case, far exceeding what anyone imagined he could do. But despite all he has achieved, his one true love eludes him.Film★8/10The Shawshank RedemptionImprisoned in the 1940s for the double murder of his wife and her lover, upstanding banker Andy Dufresne begins a new life at the Shawshank prison, where he puts his accounting skills to work for an amoral warden. During his long stretch in…Film★9/10OppenheimerThe story of J. Robert Oppenheimer's role in the development of the atomic bomb during World War II.Film★8/10Terrifier 2A year after the Miles County massacre, Art the Clown is resurrected by a sinister entity. Art returns home, where he must hunt down and destroy teenage Sienna and her younger brother Jonathan on Halloween. As the body count rises, the sibl…Film★7/10The Suicide SquadSupervillains Harley Quinn, Bloodsport, Peacemaker and a collection of nutty cons at Belle Reve prison join the super-secret, super-shady Task Force X as they are dropped off at the remote, enemy-infused island of Corto Maltese.Film★7/10MidsommarSeveral friends travel to Sweden to study as anthropologists a summer festival that is held every ninety years in the remote hometown of one of them. What begins as a dream vacation in a place where the sun never sets, gradually turns into …Film★7/1012 Angry MenThe defense and the prosecution have rested and the jury is filing into the jury room to decide if a young Spanish-American is guilty or innocent of murdering his father. What begins as an open and shut case soon becomes a mini-drama of eac…Film★9/10GlumciPradeep RanganathanUthaman PradeepIvanaNikitha ShastriAkshaya UdhayakumarShwetha IyengarRaveena RaviDivyaRadikaa SarathkumarSaraswathiPrathana NathanNamithaSathyarajVenu ShastriYogi BabuDr. YogiAdithya KathirBhaskarBhaarathManiVijay VaradharajKaushikAajeedh KhaliqueRevi