BSServer plejeravideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesJim Jefferies: Intolerant2020766 minKomedijaPremijera07. jul 2020.ZemljaUnited States of AmericaBetween scenes from an excruciating date, Jim Jefferies digs into generational differences, his own bad habits and the shifting boundaries in comedy.Similar vibes20 naslovaJim Jefferies: FreedumbReturning for a second Netflix comedy special, Jim Jefferies unleashes his famously ferocious black humor to a packed house in Nashville, Tennessee.Film★7/10Jim Jefferies: This Is Me NowThe gleefully irreverent Jefferies skewers “grabby” celebrities, political hypocrisy and his own ill-advised career moves in a brash stand-up special.Film★7/10Jim Jefferies: High n' DryNo topic is off limits for Jim Jefferies as he muses on stoned koalas, his dad’s vasectomy confusion and choosing between his hair and his sex drive.Film★6/10Jim Jefferies: AlcoholocaustShare this *Alcoholocaust: (Meaning: The aftermath of a drinking party, usually resulting in every available horizontal surface being covered in empty booze containers, spilled beverages and a general sticky alcoholic residue.) Jim Jefferie…Film★7/10Death of a VloggerAn ambitious vlogger experiences the dark side of the internet when his latest video, which features an alleged haunting, goes viral.Film★5/10DestroyerWhen Erin Bell was a young cop, she was given an undercover assignment that ended badly and destroyed her life. Years later, she must face her demons in order to make peace with her past.Film★6/10The Little Mermaid: Ariel's BeginningFollow Ariel's adventures before she gave up her fins for true love. When Ariel wasn't singing with her sisters, she spent time with her mother, Queen Athena. Ariel is devastated when Athena is killed by pirates, and after King Triton outla…Film★7/10Palm SpringsWhen carefree Nyles and reluctant maid of honor Sarah have a chance encounter at a Palm Springs wedding, things get complicated when they find themselves unable to escape the venue, themselves, or each other.Film★7/10The SpongeBob Movie: Sponge on the RunWhen his best friend Gary is suddenly snatched away, SpongeBob takes Patrick on a madcap mission far beyond Bikini Bottom to save their pink-shelled pal.Film★7/10Jojo RabbitJojo, a lonely German boy during World War II has his world shaken when he learns that his single mother is hiding a Jewish girl in their home. Influenced by a buffoonish imaginary version of Adolf Hitler, he begins to question his beliefs …Film★8/10MementoLeonard Shelby is tracking down the man who raped and murdered his wife. The difficulty of locating his wife's killer, however, is compounded by the fact that he suffers from a rare, untreatable form of short-term memory loss. Although he c…Film★8/10Your Name.High schoolers Mitsuha and Taki are complete strangers living separate lives. But one night, they suddenly switch places. Mitsuha wakes up in Taki’s body, and he in hers. This bizarre occurrence continues to happen randomly, and the two mus…Film★8/10The Shawshank RedemptionImprisoned in the 1940s for the double murder of his wife and her lover, upstanding banker Andy Dufresne begins a new life at the Shawshank prison, where he puts his accounting skills to work for an amoral warden. During his long stretch in…Film★9/10JokerDuring the 1980s, a failed stand-up comedian is driven insane and turns to a life of crime and chaos in Gotham City while becoming an infamous psychopathic crime figure.Film★8/10Zack Snyder's Justice LeagueDetermined to ensure Superman's ultimate sacrifice was not in vain, Bruce Wayne aligns forces with Diana Prince with plans to recruit a team of metahumans to protect the world from an approaching threat of catastrophic proportions.Film★8/10Everything Everywhere All at OnceAn aging Chinese immigrant is swept up in an insane adventure, where she alone can save what's important to her by connecting with the lives she could have led in other universes.Film★8/10The ReturnAfter twenty years away, Odysseus washes up on the shores of Ithaca, haggard and unrecognizable. The king has finally returned home, but much has changed in his kingdom since he left to fight in the Trojan war.Film★7/10OppenheimerThe story of J. Robert Oppenheimer's role in the development of the atomic bomb during World War II.Film★8/101917At the height of the First World War, two young British soldiers must cross enemy territory and deliver a message that will stop a deadly attack on hundreds of soldiers.Film★8/10SoulJoe Gardner is a middle school teacher with a love for jazz music. After a successful audition at the Half Note Club, he suddenly gets into an accident that separates his soul from his body and is transported to the You Seminar, a center in…Film★8/10GlumciJim JefferiesHimself