CSServer přehrávače111moviesvideasyvidsrcvidfastvidlinkvidnestmoviesapiEpizoda12345678910111213141516Sezóna1Romance Is a Bonus Book20198DramaKomedieVydáno26. 1. 2019ZeměJižní KoreaProdukceStudio DragonStory & Pictures MediaA gifted writer who's the youngest editor-in-chief ever at his publishing company gets enmeshed in the life of a former copywriter desperate for a job.Similar vibes20 titulůDoctor PrisonerAn ace doctor in a university hospital is wrongfully accused of a medical malpractice incident and gets ousted from the hospital. He then applies to work at a prison, where he plans to make personal connections with all the big shots in pri…Seriál★7/10BloodPark Ji-sang, a surgeon, leads a double life. While he tries to save his patients' lives, on the other hand, he is also a vampire who constantly craves for blood.Seriál★7/10Hillsong: A Megachurch ExposedFeaturing interviews with Hillsong insiders, megachurch experts, and Ranin Karim – the woman whose five-month affair with celebrity senior pastor Carl Lentz led to his downfall – the series explores the high-profile, star-studded church’s a…Seriál★7/10Please Feel At Ease Mr. LingA story of how the 'rabbit' brings home a 'big bad wolf' follows a young woman named Gu An Xin who chances upon the hotshot executive Ling Yue after he encountered an accident. Gu An Xin picked up a man. At first, she thought he was stupid,…Seriál★7/10Pure GeniusA young Silicon Valley tech-titan enlists a veteran surgeon with a controversial past in starting a hospital with a cutting-edge, new school approach to medicine.Seriál★6/10Save MeSave Me is a web-toon based thriller drama with a story of four young men who try to save one woman. One day, they face a woman in a dark alley who asks for their help. The woman turns out to be involved in a cult group. A sequence of horri…Seriál★8/10Strong Woman Do Bong-SoonBorn with supernatural strength, Bong-soon fights evil and procures justice while getting tangled in a love triangle with her CEO boss and cop crush.Seriál★8/10Something in the RainExplore the relationship of two people as they go from being “just acquaintances” to “a genuine couple” — Yoon Jin Ah, a coffee shop supervisor in her 30s, and Seo Joon Hee, a designer at a video game company who has just returned from wor…Seriál★8/10CollateralWhen a pizza delivery driver is shot dead in south London, a tenacious detective goes after the people traffickers behind his murder and unravels a conspiracy that goes to the top.Seriál★6/10Fight for My WayA former taekwondo champion and an information desk worker aspire to chase their dreams in a world that isn't kind to those with mediocre credentials.Seriál★8/10While You Were SleepingNam Hong Ju, endowed with the ability to foresee events, resides with her widowed mother who runs a small restaurant. Despite her gift, she often finds herself powerless to change the outcomes. On the other side of the street, Jung Jae Chan…Seriál★8/10Suspicious PartnerNoh Ji Wook is a prosecutor in the Central District Prosecutors’ Office who ends up switching professions to a private attorney. He harbors a trauma stemming from an event in his childhood involving his parents and his first love. Eun Bong …Seriál★8/10A Good Girl's Guide to MurderFive years after the death of schoolgirl Andie Bell, Pippa Fitz-Amobi sets out to uncover what really happened to her. Sal Singh, Andie's boyfriend, admitted to the murder before taking his own life, but Pip doesn't believe he's responsible…Seriál★7/10Mr. QueenA modern chef suddenly becomes trapped inside the body of a queen from the Joseon era, which causes chaos for everyone involved.Seriál★9/10Meteor GardenAn ordinary girl is admitted to the most prestigious school in the country where she encounters F4, an exclusive group comprised of the four wealthiest and handsomest boys in the school - Dao Mingsi, Hua Zelei, Xi Men and Mei Zuo.Seriál★9/10The King: Eternal MonarchKorean emperor Lee Gon tries to close the doors to a parallel world which was opened by demons; a detective tries to protect the people and the one she loves.Seriál★8/10VincenzoAt the age of eight, Park Joo Hyeong left for Italy after being adopted. Now an adult, he is known as Vincenzo Cassano and employed by a Mafia family as a consigliere. Due to warring Mafia factions, he flies to South Korea where he gets inv…Seriál★9/10Normal PeopleMarianne and Connell weave in and out of each other's lives in this exploration of sex, power and the desire to love and be loved.Seriál★8/10SuccessionFollow the lives of the Roy family as they contemplate their future once their aging father begins to step back from the media and entertainment conglomerate they control.Seriál★8/10BridgertonWealth, lust, and betrayal set in the backdrop of Regency era England, seen through the eyes of the powerful Bridgerton family.Seriál★8/10