ELKiss My AshesΔιακομιστής αναπαραγωγήςvideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesKiss My Ashes2018680 λεπτάΤρόμουΚωμωδίαΚυκλοφόρησε03 Δεκ 2018ΧώραUnited States of AmericaΠαραγωγήIndependent FilmA vampire, a nihilist, and a murderous dwarf with super powers, come together, aided by the powers of a young woman's magical penis, to fulfill an ancient prophecy and battle an ancient demon.ΗθοποιοίSimilar vibes17 τίτλοιThe Dark Side of the WombA dwarf named Ed falls in love with a big woman named Linda. He cuts her open and climbs into her womb to be "born again."Ταινία★9/10Killer TherapyΈνας ψυχικά ασταθής νεαρός άνδρας πηγαίνει σε μια αποστολή να κυνηγήσει και να δολοφονήσει όλους τους θεραπευτές που κατηγορεί για το χάσιμο του μυαλού και της ζωής του.Ταινία★5/10TiesΤαινία★8/10Highly DangerousA US newsman and a British entomologist spy on germ-warfare research in a mythical country.Ταινία★6/10The Art Of WaitingLiran and Tali, a couple in their thirties who dream of having a child together, are one day told that they will have to undergo fertility treatments. What seems simple at first turns out to be very complex.Ταινία★9/10AntimanA young boy must prove his masculinity to his father while he pines for a young man in the homophobic Guyanese countryside.Ταινία★3/10Six Reasons WhyIn a desolate place called the Badlands, four men stand off with guns drawn, their fingers ready at the trigger. Among them are a fugitive seeking redemption, a son out to avenge his father's murder, a loyal servant with a secret and a murd…Ταινία★5/10BarrierA dream-like meditation on post-industrial life in Communist Poland.Ταινία★7/10WanderlandA New York City man, Alex, takes an off-season trip to the Hamptons in attempt to escape his routine life in the city. While trying to spend his time relaxing, Alex ends up lost, putting him in contact with some life-changing locals during …Ταινία★6/10Bob the Builder: When Bob Became a BuilderWhile building a new picnic area at the beach, Bob and the machines tell Benny and Scrambler the story of how he got started as a builder. Bob then recounts he and his dad Robert constructed the building yard in Bobsville, and how the machi…Ταινία★7/10Red Shock Asami KubotaAsami-chan is ready for take-off.Ταινία★8/10Underground Entertainment: The MovieOn the 20th anniversary of their edgy little 90's cable show Underground Entertainment, the authors, along with many SF, horror and B celebrities in cameos, remember how they pushed the envelope, shocked, entertained, but also introduced th…Ταινία★7/10American JailIn this deeply personal film, director Roger Ross Williams sets out on a journey to understand the complex forces of racism and greed currently at work in America's prison system.Ταινία★5/10Let's Call Her LisaWith her the husband and her mother Katya lives in a small provincial town and works at the local factory. The mother suddenly falls ill and decides to transfer her property to her son, Katya’s brother. Katya feels this decision to be unjus…Ταινία★6/10Space Journey: The First Dream of Wonder-kunThis is the story of a friendship between a boy named Taro and the mysterious Wonder-kun, using "the first dream of the New Year" as a motif. Guided by Wonder-kun, Taro departs on a space trip searching for adventure...Ταινία★4/10Jerry, Jerry, Quite ContraryJerry keeps sleepwalking and doing things unknowingly to Tom. He becomes aware of this and tries to stay awake.Ταινία★6/10Near WinterNear Winter tells of a young Norwegian man returning home to an isolated farm with his English girlfriend only to find something is wrong with his hermit-like uncle who lives there and who is prepping for the coming winter.Ταινία★5/10