ENThe Devil Has a NamePlayer servervideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesThe Devil Has a Name2019597 minDramaComedyThrillerReleasedAug 04, 2019CountryUnited States of AmericaProductionsTrue Navigator MediaFour Horsemen FilmsStoryBoard MediaAn oil baron and a farmer standoff after the water on his farm is poisoned by her company.ActorsDavid StrathairnFred SternKate BosworthGigiPablo SchreiberEzekielEdward James OlmosSantiagoKatie AseltonOliveHaley Joel OsmentAlexKathleen QuinlanNancyAlfred MolinaBig BossMartin SheenRalphChivonne MichelleBethKatie Lynn McDowellSamTahmoh PenikettAndersSimilar vibes20 titlesThe VirtuosoDanger, deception and murder descend upon a sleepy town when a professional assassin accepts a new assignment from his enigmatic boss.Movie★6/10Fast ConvoyMálaga, southern Spain. Seven men, divided into four cars, set off with a large drug shipment towards Creil, a city near Paris; a routine mission that will be complicated by a fatal sequence of events.Movie★6/10MilitiaWhen deadly anthrax missiles are stolen by a militia, ATF agent Ethan Carter must go undercover and join the group to save the country from disaster.Movie★4/10Loves Me, Loves Me NotAli Silver searches for Mr. Right but finds misadventures that are darkly outrageous and sexy with an assortment of ne'er-do-wells who are inappropriate, unobtainable or unmanageable. Looking for Mr. Goodbar meets Sex and the City.Movie★4/10Faan's TrainFaan se Trein is about a simple-minded man living in a tiny Karoo community. When his father dies, leaving all his possessions to Faan and the church, greed rears its head and divides the community... Until love restores their sanity.Movie★6/10KrampusWhen his dysfunctional family clashes over the holidays, young Max is disillusioned and turns his back on Christmas. Little does he know, this lack of festive spirit has unleashed the wrath of Krampus: a demonic force of ancient evil inten…Movie★6/10Love and MonstersSeven years since the Monsterpocalypse began, Joel Dawson has been living underground in order to survive. But after reconnecting over radio with his high school girlfriend Aimee, Joel decides to venture out to reunite with her, despite all…Movie★7/10Ready or NotA young bride's wedding night turns into her worst nightmare when her ridiculously rich in-laws force her to play a gruesome game of hide-and-seek.Movie★7/10No Time to DieBond has left active service and is enjoying a tranquil life in Jamaica. His peace is short-lived when his old friend Felix Leiter from the CIA turns up asking for help. The mission to rescue a kidnapped scientist turns out to be far more t…Movie★7/10OppenheimerThe story of J. Robert Oppenheimer's role in the development of the atomic bomb during World War II.Movie★8/10The FavouriteEngland, early 18th century. The close relationship between Queen Anne and Sarah Churchill is threatened by the arrival of Sarah's cousin, Abigail Hill, resulting in a bitter rivalry between the two cousins to be the Queen's favourite.Movie★7/10The Florida ProjectThe story of a precocious six year-old and her ragtag group of friends whose summer break is filled with childhood wonder, possibility and a sense of adventure while the adults around them struggle with hard times.Movie★7/10MulanWhen the Emperor of China issues a decree that one man per family must serve in the Imperial Chinese Army to defend the country from Huns, Hua Mulan, the eldest daughter of an honored warrior, steps in to take the place of her ailing father…Movie★7/10Green BookTony Lip, a bouncer in 1962, is hired to drive pianist Don Shirley on a tour through the Deep South in the days when African Americans, forced to find alternate accommodations and services due to segregation laws below the Mason-Dixon Line,…Movie★8/10HalloweenLaurie Strode comes to her final confrontation with Michael Myers, the masked figure who has haunted her since she narrowly escaped his killing spree on Halloween night four decades ago.Movie★7/10JokerDuring the 1980s, a failed stand-up comedian is driven insane and turns to a life of crime and chaos in Gotham City while becoming an infamous psychopathic crime figure.Movie★8/1012 Angry MenThe defense and the prosecution have rested and the jury is filing into the jury room to decide if a young Spanish-American is guilty or innocent of murdering his father. What begins as an open and shut case soon becomes a mini-drama of eac…Movie★9/10InceptionCobb, a skilled thief who commits corporate espionage by infiltrating the subconscious of his targets is offered a chance to regain his old life as payment for a task considered to be impossible: "inception", the implantation of another per…Movie★8/10The Two PopesFrustrated with the direction of the church, Cardinal Bergoglio requests permission to retire in 2012 from Pope Benedict. Instead, facing scandal and self-doubt, the introspective Pope Benedict summons his harshest critic and future success…Movie★7/10Avengers: EndgameAfter the devastating events of Avengers: Infinity War, the universe is in ruins due to the efforts of the Mad Titan, Thanos. With the help of remaining allies, the Avengers must assemble once more in order to undo Thanos' actions and resto…Movie★8/10