ESServidor del reproductorvideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesTrevor Noah: Where Was I2023668 minComediaDocumentalEstreno18 dic 2023PaísUnited States of AmericaProducciónDay Zero ProductionsTrevor Noah riffs on national anthems, derailing a German sightseeing tour and getting roasted in Paris in this comedy special about his world travels.Similar vibes20 títulosHappiness for BeginnersAt a crossroads after her divorce, a schoolteacher ventures toward a fresh start in life — and love — when she signs up for a grueling group hiking trip.Película★6/10Trevor Noah: Afraid of the DarkThe 'Daily Show' host ponders the perils of naming countries, how traffic lights turn New Yorkers invincible and why you shouldn't drink in Scotland.Película★7/10Anthony Jeselnik: Bones and AllAnthony Jeselnik celebrates 20 years of delivering boundary-pushing comedy to the masses in this razor-sharp stand-up special.Película★7/10Space MilkshakeFour low-ranking astronauts are stuck together on an orbital Sanitation Station after they bring a mysterious device aboard their ship and all life on Earth disappears. Little do they know they are about to come under attack by a mutating r…Película★5/10Leo Reich: Literally Who Cares?!Hot. Young. Cool. Fresh. Ripped. Hilarious. Groundbreaking. Avant-garde. These are just some of the words that comedian and writer Leo Reich uses to describe himself. In his first HBO comedy special, this self-diagnosed important young mind…Película★5/10MonsterAfter an outburst at school involving her son, a concerned single mother demands answers, triggering a sequence of deepening suspicion and turmoil.Película★8/10Rebel RidgeA former Marine confronts corruption in a small town when local law enforcement unjustly seizes the bag of cash he needs to post his cousin's bail.Película★7/10Leave the World BehindA family's getaway to a luxurious rental home takes an ominous turn when a cyberattack knocks out their devices—and two strangers appear at their door.Película★6/10The FlashWhen his attempt to save his family inadvertently alters the future, Barry Allen becomes trapped in a reality in which General Zod has returned and there are no Super Heroes to turn to. In order to save the world that he is in and return to…Película★7/10OppenheimerThe story of J. Robert Oppenheimer's role in the development of the atomic bomb during World War II.Película★8/10Titanic101-year-old Rose DeWitt Bukater tells the story of her life aboard the Titanic, 84 years later. A young Rose boards the ship with her mother and fiancé. Meanwhile, Jack Dawson and Fabrizio De Rossi win third-class tickets aboard the ship. …Película★8/10JokerDuring the 1980s, a failed stand-up comedian is driven insane and turns to a life of crime and chaos in Gotham City while becoming an infamous psychopathic crime figure.Película★8/10Dune: Part TwoFollow the mythic journey of Paul Atreides as he unites with Chani and the Fremen while on a path of revenge against the conspirators who destroyed his family. Facing a choice between the love of his life and the fate of the known universe,…Película★8/10CompanionDuring a weekend getaway at a secluded lakeside estate, a group of friends finds themselves entangled in a web of secrets, deception, and advanced technology. As tensions rise and loyalties are tested, they uncover unsettling truths about t…Película★7/10PKA stranger in the city asks questions no one has asked before. Known only by his initials, the man's innocent questions and childlike curiosity take him on a journey of love, laughter and letting go.Película★8/10SinnersTrying to leave their troubled lives behind, twin brothers return to their hometown to start again, only to discover that an even greater evil is waiting to welcome them back.Película★7/10Top Gun: MaverickAfter more than thirty years of service as one of the Navy’s top aviators, and dodging the advancement in rank that would ground him, Pete “Maverick” Mitchell finds himself training a detachment of TOP GUN graduates for a specialized missio…Película★8/10Green BookTony Lip, a bouncer in 1962, is hired to drive pianist Don Shirley on a tour through the Deep South in the days when African Americans, forced to find alternate accommodations and services due to segregation laws below the Mason-Dixon Line,…Película★8/10Deadpool & WolverineA listless Wade Wilson toils away in civilian life with his days as the morally flexible mercenary, Deadpool, behind him. But when his homeworld faces an existential threat, Wade must reluctantly suit-up again with an even more reluctant Wo…Película★8/10Once Upon a Time... in HollywoodLos Angeles, 1969. TV star Rick Dalton, a struggling actor specializing in westerns, and stuntman Cliff Booth, his best friend, try to survive in a constantly changing movie industry. Dalton is the neighbor of the young and promising actres…Película★7/10ActoresTrevor NoahSelf