ESServidor del reproductorvideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesTerrifier2018684 minTerrorSuspenseEstreno25 ene 2018PaísUnited States of AmericaProducciónDark Age CinemaA maniacal clown named Art terrorizes three young women on Halloween night and everyone else who stands in his way.ActoresDavid Howard ThorntonArt the ClownJenna KanellTara HeyesSamantha ScaffidiVictoria HeyesCatherine CorcoranDawnPooya MohseniCat LadyMatt McAllisterMike the ExterminatorKatie MaguireMonica BrownGino CafarelliStevenCory DuValCoronerMichael LeavyExterminator #2XiomiEMT RomanErick ZamoraRamoneSimilar vibes20 títulosTerrifier 2A year after the Miles County massacre, Art the Clown is resurrected by a sinister entity. Art returns home, where he must hunt down and destroy teenage Sienna and her younger brother Jonathan on Halloween. As the body count rises, the sibl…Película★7/10All Hallows' EveWhile watching two children on Halloween night, a babysitter finds an old VHS tape in the kids' trick or treat bag. The tape features three tales of terror, all linked together by a murderous clown.Película★6/10TerrifierAfter witnessing a brutal murder on Halloween night, a young woman becomes the next target of a maniacal entity.Película★6/10Terrifier 3Five years after surviving Art the Clown's Halloween massacre, Sienna and Jonathan are still struggling to rebuild their shattered lives. As the holiday season approaches, they try to embrace the Christmas spirit and leave the horrors of th…Película★7/10The Lodgers1920, rural Ireland. Anglo-Irish twins Rachel and Edward share a strange existence in their crumbling family estate. Each night, the property becomes the domain of a sinister presence (The Lodgers) which enforces three rules upon the twins:…Película★5/10DeadstreamA disgraced internet personality attempts to win back his followers by livestreaming one night alone in a haunted house. But when he accidentally pisses off a vengeful spirit, his big comeback event becomes a real-time fight for his life.Película★6/10The Hills Have EyesBased on Wes Craven's 1977 suspenseful cult classic, The Hills Have Eyes is the story of a family road trip that goes terrifyingly awry when the travelers become stranded in a government atomic zone. Miles from nowhere, the Carter family so…Película★6/10Level 16The teenage girls of Vestalis Academy are meticulously trained in the art of being “clean girls,” practicing the virtues of perfect femininity. But what exactly are they being trained for? Vivien intends to find out.Película★7/10DuelTraveling businessman David Mann angers the driver of a rusty tanker while crossing the California desert. A simple trip turns deadly, as Mann struggles to stay on the road while the tanker plays cat and mouse with his life.Película★7/10FreshFrustrated by scrolling dating apps only to end up on lame, tedious dates, Noa takes a chance by giving her number to the awkwardly charming Steve after a produce-section meet-cute at the grocery store.Película★7/10HellraiserA young woman struggling with addiction comes into possession of an ancient puzzle box, unaware that its purpose is to summon the Cenobites, a group of sadistic supernatural beings from another dimension.Película★6/10BarbarianIn town for a job interview, a young woman arrives at her Airbnb late at night only to find that it has been mistakenly double-booked and a strange man is already staying there. Against her better judgement, she decides to stay the night an…Película★7/10Funny GamesTwo psychotic young men take a mother, father, and son hostage in their vacation cabin and force them to play sadistic "games" with one another for their own amusement.Película★7/10The Little Mermaid II: Return to the SeaSet several years after the first film, Ariel and Prince Eric are happily married with a daughter, Melody. In order to protect Melody from the Sea Witch, Morgana, they have not told her about her mermaid heritage. Melody is curious and vent…Película★6/10ShutterWhen Jane and Tun run over a girl in a car accident, they speed away immediately from the crime scene. However, Tun, a photographer, soon discovers strange shadows in his photos, which unsettles them.Película★7/10MonstrousLaura, traumatized by an abusive relationship, runs away from her former husband with her seven-year-old son Cody. But in their new, idyllic and remote sanctuary, they find they have another, bigger and more terrifying monster to deal with…Película★6/10Armed ResponseThe story follows a team of highly trained operatives who find themselves trapped inside an isolated military compound.Película★5/10Kidnapping StellaSnatched off the street and held for ransom, a bound and gagged woman uses her limited powers to derail her two masked abductors' carefully laid plans.Película★5/10WildlingA young woman held in captivity discovers the realities of truth and lies in the outside world.Película★5/10DemonicA young woman unleashes terrifying demons when supernatural forces at the root of a decades-old rift between mother and daughter are ruthlessly revealed.Película★5/10