ESServidor del reproductorvideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesMonica, O My Darling20227129 minDramaComediaSuspenseCrimenMisterioEstreno11 nov 2022PaísIndiaProducciónMatchbox ShotsA slick robotics expert joins a murderous plot after a passionate affair takes a sudden turn, but nothing — not even death — is what it seems to be.Similar vibes20 títulosBrahmāstra Part One: ShivaThe story of Shiva – a young man on the brink of an epic love, with a girl named Isha. But their world is turned upside down when Shiva learns that he has a mysterious connection to the Brahmāstra... and a great power within him that he doe…Película★6/10AlonersJina is the top employee at a credit card company call center. She avoids building close relationships, choosing instead to live and work alone – until she is suddenly tasked with training a new recruit.Película★7/10Cell PhoneFollows the story of a television host who's hidden so much personal and secret information on his phone, that when it gets out, catastrophe strikes.Película★6/10An Action HeroAt the age of just 30, Maanav at the peak of his acting career gets caught up in a murder accusation, which turns his own life into an eccentric action thriller as he flees the country, with a vengeful politician hot on his heels.Película★7/10Mrs. Chatterjee Vs NorwayAn immigrant Indian mother fights the Norwegian foster care system and legal machinery to win back custody of her children.Película★6/10The Last of SheilaA year after Sheila is killed in a hit-and-run, her multimillionaire husband invites a group of friends to spend a week on his yacht playing a scavenger hunt-style mystery game—but the game turns out to be all too real and all too deadly.Película★7/10AjoommaA widow obsessed with Korean soap operas travels abroad for the first time in her life and finds more than she bargained for in Seoul.Película★7/10Manorama Six Feet UnderSatyaveer is an engineer suspended for allegedly accepting a bribe. However, Satyaveer, proud author of a tawdry and thoroughly unsuccessful crime novel, is approached by a woman named Manorama to investigate her husband, whom she suspects …Película★7/10Dhokha: Round D CornerWhen a delusional housewife with a personality disorder is taken hostage by a terrorist on the loose and a husband accused of cheating on his wife have their own versions of reality, how do we know who's saying the truth?Película★5/10Love TodayA young couple is made to exchange their phones for a day. What follows is a hilarious and emotional sequence of events that puts their lives in misery.Película★7/10K.G.F: Chapter 1A period drama set in the 1970s, KGF follows the story of a fierce rebel who rises against the brutal oppression in Kolar Gold Fields and becomes the symbol of hope to legions of downtrodden people.Película★7/10ResolutionA man imprisons his estranged junkie friend in an isolated cabin in the boonies of San Diego to force him through a week of sobriety, but the events of that week are being mysteriously manipulated.Película★6/10DilwaleRaj is a Mafia member. One day he meet a girl (Meera) while chasing by his rival gang and falls in love with her. Later he finds out that this girl is the daughter of the leader of his rival gang. Yet their love story continues until he was…Película★7/10MaXXXineIn 1980s Hollywood, adult film star and aspiring actress Maxine Minx finally gets her big break. But as a mysterious killer stalks the starlets of Hollywood, a trail of blood threatens to reveal her sinister past.Película★6/10FollowingBill, an idle, unemployed aspiring writer, walks the crowded streets of London following randomly chosen strangers, a seemingly innocent entertainment that becomes dangerous when he crosses paths with a mysterious character.Película★7/10Enola Holmes 2Now a detective-for-hire like her infamous brother, Enola Holmes takes on her first official case to find a missing girl, as the sparks of a dangerous conspiracy ignite a mystery that requires the help of friends — and Sherlock himself — to…Película★7/10Joker: Folie à DeuxWhile struggling with his dual identity, Arthur Fleck not only stumbles upon true love, but also finds the music that's always been inside him.Película★5/10Glass Onion: A Knives Out MysteryWorld-famous detective Benoit Blanc heads to Greece to peel back the layers of a mystery surrounding a tech billionaire and his eclectic crew of friends.Película★7/10Everything Everywhere All at OnceAn aging Chinese immigrant is swept up in an insane adventure, where she alone can save what's important to her by connecting with the lives she could have led in other universes.Película★8/10Batman v Superman: Dawn of JusticeFearing the actions of a god-like Super Hero left unchecked, Gotham City’s own formidable, forceful vigilante takes on Metropolis’s most revered, modern-day savior, while the world wrestles with what sort of hero it really needs. And with B…Película★6/10ActoresRajkummar RaoJayant ArkhedkarHuma QureshiMonica MachadoRadhika ApteACP Vyjayanti NaiduSikandar KherNishikant AdhikariBagavathi PerumalArvind ManivannanAkansha Ranjan KapoorNikki AdhikariZayn Marie KhanSarika 'Shalu' VartakSukant GoelGaurav MoreShiva RindaniTamang RanaVijay KenkreSatyanarayan AdhikariFaisal RashidFaridi BaigRadhikka MadanSupri