FAسرور پخشکننده111moviesvideasyvidsrcvidfastvidlinkvidnestmoviesapiقسمت123456فصل1S Line20258درامرازفانتزی و علمی تخیلیانتشار۲۰ تیر ۱۴۰۴کشورکرهٔ جنوبیCreatorsAhn Ju-youngKkomabiتولیدSidusA young woman with the ability to see mysterious red connections between lovers discovers her secret gift is no longer unique when special glasses granting similar powers appear on the black market.Similar vibes20 عنوانMay It Please the CourtNoh Chak-hee, the ace lawyer of the big law firm, Jangsan, becomes a public defender overnight and must defend the criminal who killed her loved one.سریال★7/10Where Stars LandAt Incheon International Airport, brilliant but distant engineer Lee Soo-yeon and clumsy, idealistic rookie Han Yeo-reum cross paths as they navigate tough challenges, personal secrets, and unexpected connections in their new jobs.سریال★7/10Love (ft. Marriage and Divorce)Everything comes unraveling for three successful women who work on a radio show as twists, turns and troubles plague their seemingly happy marriages.سریال★7/10Midnight Horror: Six NightsAs the modern life wears them down and the nights take the light, bizarre things start happening to six different women.سریال★5/10Our MovieA director with no future and an actress with no tomorrow fall into a love story that cannot wait.سریال★9/10Secret LoveA falsely accused Yoo Jung fights her innocence against her prosecutor's fiancée and an insane heir to a conglomerate.سریال★8/10Low LifeA dangerous story of rough people obsessed with shameless greed who gather together with their own greed and logic to find underwater artifacts off the coast of Shinan.سریال★7/10DeliriumWhen his wife Agustina falls into delirium, a professor delves into her dark past to piece together her story and uncover the cause of her madness.سریال★7/10Marry My Husband: JapanMisa has been a supporting character all her life, blindly trusting her best friend and husband. When she discovers their affair, the betrayal results in her death. Waking up ten years in the past, Misa vows to become the main character of …سریال★8/10TriggerAs illegal firearms flood into a gun-free South Korea, a resolute cop and a mysterious partner join forces to stop the chaos from sweeping the nation.سریال★8/10EncounterFollowing a chance encounter overseas, a woman with much to lose and a man with little to his name meet again as employer and employee.سریال★8/10BallardDetective Renée Ballard plunges into a web of murder and corruption as she hunts a ruthless serial killer and uncovers a sinister police conspiracy that threatens everything she stands for. With her own demons nipping at her heels, Ballard …سریال★7/10Save MeSave Me is a web-toon based thriller drama with a story of four young men who try to save one woman. One day, they face a woman in a dark alley who asks for their help. The woman turns out to be involved in a cult group. A sequence of horri…سریال★8/10Blossoms ShanghaiSet against the backdrop of massive economic growth in the 1990s, the story follows A Bao, a self-made millionaire and his journey from being a young opportunist with a troubled past to accumulating dazzling wealth in the city of Shanghai. …سریال★9/10The All-Devouring Whale: HomecomingFan Lingxiao, a spiritual pet master with exceptional talents, was plotted against during the Level-A sect promotion competition and was devoured by Kun, his own spiritual pet. When he opened his eyes again, he found himself reincarnated in…سریال★8/10Dear HongrangWhen a long-missing heir returns with lost memories, love and suspicion entwine. Is he truly Hongrang, or a stranger disturbing hearts and family ties?سریال★7/10Revenged LoveAfter Wu Suo-wei's girlfriend dumps him, he decides to get revenge by seducing her new boyfriend, Chi Cheng! It started as a game, but falling in love was never part of the plan.سریال★8/10ConnectDongsoo leads a solitary life, spending his time uploading music to the internet. His ordinary life is upended when he is kidnapped by an organ hunter, who takes out one of his eyes. Soon, Dongsoo is sharing the vision of someone who got …سریال★8/10Around the World in 80 DaysFollowing an outrageous bet, Fogg and his valet, Passepartout, take on the legendary journey of circumnavigating the globe in just 80 days, swiftly joined by aspiring journalist Abigail Fix, who seizes the chance to report on this extraordi…سریال★7/10Head Over HeelsA teenage shaman determined to change fate sets out to save a mysterious boy destined to die. As danger looms, their fated encounter sparks a powerful first love that defies darkness and reclaims hope.سریال★9/10