FIToistimen palvelinvideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesHoliday20146170 minToimintaTrilleriRikosJulkaistu06.6.2014MaaIndiaTuotannotReliance EntertainmentHari Om EntertainmentVirat Bakshi, an Indian army soldier on vacation stumbles upon a terror plot to rip Mumbai apart with a series of bomb blasts and must hunt down the sleeper cell of the terror organisation before it's too late.NäyttelijätAkshay KumarCaptain Viraat BakshiSonakshi SinhaSaiba ThaparFreddy DaruwalaFarhad AliGovindaMajor Pratap PanikarSumeet RaghvanMukund DeshmukhZakir HussainAlvin D'souzaApoorva AroraPinkie BakshiCherry MardiaPreeti BakshiGireesh SahdevACP Ashok GaikwadRajiv KachrooNoelRandheer RaiLieutenant William Martin JoelPremnath GulatiMr. BakshiSimilar vibes20 nimikettäGirl Most LikelyA failed New York playwright stages a suicide in an attempt to win back her ex, only to wind up in the custody of her gambling-addict mother.Elokuva★6/10Ek VillainAn ex-gangster re-enters the world of violence after his wife is murdered by a serial killer.Elokuva★7/10DrishyamA simple street-smart man tries to protect his family from a cop looking for her missing son who was accidently killed by his daughter.Elokuva★8/10Dum Laga Ke HaishaA slim uneducated guy is pressured into an arranged marriage with an overweight college girl. The mismatched couple is challenged to compete in the annual wife-carrying race.Elokuva★7/10Special 26During the 1980s in India, a group of con artists rob businessmen and politicians by conducting fake raids, posing as officers of the CBI or Income Tax Department . They plan to execute their biggest con as a final job while a relentless co…Elokuva★7/10HousefullBelieving himself to be a jinx and bringing bad luck upon himself and others, a man attempts to find true love, but ends up in very complicated relationships.Elokuva★6/10PulimuruganMurugan, with his tools and expertise, protects Puliyoor's villagers from deadly tiger attacks. However, Daddy, an illegal drugs dealer, takes advantage of Murugan's innocence and wrongly frames him.Elokuva★6/10KickAn adrenaline junkie walks away from a whirlwind romance and embraces a new life as a thief, though he soon finds himself pursued by veteran police officer and engaged in a turf war with a local gangster.Elokuva★6/10Singh Is BliingRaftaar Singh is always looking to have fun and runs away from responsibility. Fed up, his father orders Raftaar to go to Goa and work, and learn to take on responsibility. Once in Goa, he impresses his new boss with his enthusiasm and crea…Elokuva★5/10IA deformed hunchback kidnaps a bride and holds her hostage while his connection to her and his targets is revealed in a series of flashbacks that unfold as he starts seeking revenge.Elokuva★7/10BossDisowned by his father as a boy, Surya is taken in by a crime boss. When his brother Shiv is wrongly imprisoned, his father pleads for Surya's help.Elokuva★6/10Naam ShabanaShabana Khan, a special agent, is entrusted with the task of assassinating a deadly arms dealer by the Indian Intelligence Agency.Elokuva★6/10KoylaA village girl agrees to a marriage to a king she has never met after he sends her a photograph of himself. But the man in the photograph is not the king but his most loyal slave, the handsome but mute Shankar.Elokuva★7/10HeropantiTwo young people find love despite the violent landscape in which they live.Elokuva★6/10BaaziA tough and honest police officer wages a one-man war against terrorists and a corrupt politician who have planned to assassinate the chief minister of the state.Elokuva★7/10BallerinaGrieving the loss of a best friend she couldn't protect, an ex-bodyguard sets out to fulfill her dear friend's last wish: sweet revenge.Elokuva★7/10Panic RoomTrapped in their New York brownstone's panic room, a hidden chamber built as a sanctuary in the event of break-ins, newly divorced Meg Altman and her young daughter Sarah play a deadly game of cat-and-mouse with three intruders - Burnham, R…Elokuva★7/10Warm BodiesAfter a zombie becomes involved with the girlfriend of one of his victims, their romance sets in motion a sequence of events that might transform the entire lifeless world.Elokuva★7/10GodzillaFord Brody, a Navy bomb expert, has just reunited with his family in San Francisco when he is forced to go to Japan to help his estranged father, Joe. Soon, both men are swept up in an escalating crisis when an ancient alpha predator arises…Elokuva★6/10The Amazing Spider-Man 2For Peter Parker, life is busy. Between taking out the bad guys as Spider-Man and spending time with the person he loves, Gwen Stacy, high school graduation cannot come quickly enough. Peter has not forgotten about the promise he made to Gw…Elokuva★7/10