FRServeur du lecteurvideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesFear Strikes Out19577100 minDrameSortie28 mars 1957PaysUnited States of AmericaProductionParamount PicturesTrue story of the life of Jimmy Piersall, who battled mental illness to achieve stardom in major league baseball.Similar vibes20 titresCommandoJohn Matrix, the former leader of a special commando strike force that always got the toughest jobs done, is forced back into action when his young daughter is kidnapped. To find her, Matrix has to fight his way through an array of punks, k…Film★7/10Tab Hunter ConfidentialThroughout the 1950s, Tab Hunter reigned as Hollywood’s ultimate male heartthrob. But throughout his years of stardom, Tab had a secret. Tab Hunter was gay, and spent his Hollywood years in a precarious closet that repeatedly threatened to …Film★7/10AsThree years after the death of her beloved child, Elouise, Mara still feels her presence when she sits on the butterfly bedding in front of the jar with her ashes in it. Mara arranges a twelfth birthday party for Elouise, further alienating…Film★7/10MuzzleLAPD K-9 officer Jake Rosser has just witnessed the shocking murder of his dedicated partner by a mysterious assailant. As he investigates the shooter’s identity, he uncovers a vast conspiracy that has a choke-hold on the city in this thril…Film★7/10Next Goal WinsDutch coach Thomas Rongen attempts the nearly impossible task of turning the American Samoa soccer team from perennial losers into winners.Film★6/10Top Gun: MaverickAfter more than thirty years of service as one of the Navy’s top aviators, and dodging the advancement in rank that would ground him, Pete “Maverick” Mitchell finds himself training a detachment of TOP GUN graduates for a specialized missio…Film★8/10Return to Horror HighA few years ago, a mysterious serial-killer caused panic on Crippen High School. The killer was never caught. A movie company, Cosmic Pictures, has decided to make a feature movie about these events - on location, at the now abandoned schoo…Film★5/10The Burning SeaAn oil platform dramatically goes down on the Norwegian coast, and researchers try to find out what happened when they realize this is just the start of something even more serious.Film★7/10Sound of FreedomThe story of Tim Ballard, a former US government agent, who quits his job in order to devote his life to rescuing children from global sex traffickers.Film★8/10The Small VictoriesBetween her roles as mayor and teacher in the small village of Kerguen, Alice's days are very full. When an unexpected new student, 60-year-old Emile, finally decides to learn to read and write, her daily life threatens to become unmanageab…Film★7/10The Marsh King's DaughterHelena, a woman living a seemingly ordinary life, hides a dark secret—her father is the infamous 'Marsh King', the man who kept her and her mother captive in the wilderness for years. After a lifetime of trying to escape her past, Helena is…Film★6/10Karate Kid: LegendsAfter a family tragedy, kung fu prodigy Li Fong is uprooted from his home in Beijing and forced to move to New York City with his mother. When a new friend needs his help, Li enters a karate competition – but his skills alone aren't enough.…Film★7/10MonsterAfter an outburst at school involving her son, a concerned single mother demands answers, triggering a sequence of deepening suspicion and turmoil.Film★8/10Jurassic World RebirthFive years after the events of Jurassic World Dominion, covert operations expert Zora Bennett is contracted to lead a skilled team on a top-secret mission to secure genetic material from the world's three most massive dinosaurs. When Zora's…Film★6/10Bullet TrainUnlucky assassin Ladybug is determined to do his job peacefully after one too many gigs gone off the rails. Fate, however, may have other plans, as Ladybug's latest mission puts him on a collision course with lethal adversaries from around …Film★7/10Blue BeetleRecent college grad Jaime Reyes returns home full of aspirations for his future, only to find that home is not quite as he left it. As he searches to find his purpose in the world, fate intervenes when Jaime unexpectedly finds himself in po…Film★7/10The President's WifeWhen she arrived at the Elysée Palace, Bernadette Chirac expected to finally get the place she deserved, she who had always worked in the shadow of her husband to make him president. Put aside because she was considered too old-fashioned, B…Film★6/10The CreatorAmid a future war between the human race and the forces of artificial intelligence, a hardened ex-special forces agent grieving the disappearance of his wife, is recruited to hunt down and kill the Creator, the elusive architect of advanced…Film★7/10SpiderA young man tries to make things right again in his relationship after he and his girlfriend get in a fight.Film★6/10The Worst DaysFour episodes – Christmas, May 1st (Labour Day), August 15th (Ferragosto), Halloween – to tell four stories that delve into the human soul.Film★6/10ActeursAnthony PerkinsJimmy PiersallKarl MaldenJohn PiersallNorma MooreMary PiersallAdam WilliamsDoctor BrownPerry WilsonMrs. John PiersallPeter J. VotrianJim Piersall as a BoyRichard BullReporter Slade (uncredited)Morgan JonesSandy Allen (uncredited)Edd ByrnesBoy in Car Assisting Jimmy Up Stairway (uncredited)Brian G. HuttonBernie Sherwill (uncredited)Bart BurnsJoe Cronin (uncredited)