FRFashion KingServeur du lecteurvideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesÉpisode1234567891011121314151617181920Saison1Fashion King20126DrameSortie19 mars 2012PaysCorée du SudProductionSM EntertainmentA story of young people who make their start in the Dongdaemun market and try to succeed as world-class designers.Similar vibes19 titresBobby's WorldBobby Generic lives in a typical suburban neighborhood and uses his overactive imagination to discover a world of daring adventure, incredible wonder and lots of laughs — all in pint-sized perspective.Série★7/10Dexter: ResurrectionDexter Morgan awakens from a coma to find Harrison gone without a trace. Realizing the weight of what he put his son through, Dexter sets out for New York City, determined to find him and make things right. But closure won't come easy. When…Série★9/10Bosch: LegacyBosch is now making a living as a private investigator two years after he quit the LAPD and finds himself working with one time enemy and top-notch attorney Honey “Money” Chandler. Meanwhile, Bosch's daughter Maddie is venturing into the wo…Série★8/10Eek! The CatKoombaya, it's Eek the cat and all his friends. Annabelle, Eek's 800-pound girlfriend, Sharky the vicious but lovable sharkdog, and Elmo the elk. Plus you can watch the Terrible Thunderlizards try to make Bill and Scooter, the cavemen, exti…Série★7/10Dexter: New Blood10 years after Dexter went missing in the eye of Hurricane Laura, we find him living under an assumed name in the small town of Iron Lake, New York. Dexter may be embracing his new life, but in the wake of unexpected events in this close-k…Série★8/10X-Men: EvolutionTeenagers Cyclops, Jean Grey, Rogue, Nightcrawler, Shadowcat, and Spike fight for a world that fears and hates them.Série★8/10Once Upon a Time... LifeAttention please! Are you ready for an adventurous tour through the human body? With a lot of humour, our physical appearance is being introduced from head to toe along cells and organs in an educational way. The heart, blood, nerves and ki…Série★8/10TaskIn the working-class suburbs of Philadelphia, an FBI agent heads a task force assembled to put an end to a string of violent robberies led by an unsuspecting family man.Série★7/10The SinnerIn a small New York town, a haunted detective hunts for answers about perplexing crimes while wrestling with his own demons.Série★7/10MuñecasEva is an unconventional psychologist who guides a group of lesbian and bisexual women in group therapy to deal with their affective and sexual conflicts. Middle-aged women, residents of Madrid and living a second adolescence.Série★4/10Dragon BallYoung Goku sets off on a quest with his teenage friend Bulma to find the seven Dragon Balls, which grant whoever possesses them a single wish.Série★8/10The King of QueensLife’s good for deliveryman Doug Heffernan, until his newly widowed father-in-law, Arthur, moves in with him and his wife Carrie. Doug is no longer the king of his domain, and instead of having a big screen television in his recently renova…Série★7/10Codename: Kids Next DoorTaking numbers instead of names, five extraordinary 10-year-olds form a covert team called the Kids Next Door with one dedicated mission: to free all children from the tyrannical rule of adults.Série★8/10The Golden GirlsFour Southern Florida seniors share a house, their dreams, and a whole lot of cheesecake. Bright, promiscuous, clueless and hilarious, these lovely, mismatched ladies form the perfect circle of friends.Série★8/10The Sarah Jane AdventuresSarah Jane Smith is a truly remarkable woman who inhabits a world of mystery, danger and wonder; a world where aliens are commonplace and the Earth is under constant threat. A world that Maria Jackson, a seemingly ordinary girl, can only dr…Série★7/10LifeDavid Attenborough looks at the extraordinary ends to which animals and plants go in order to survive. Featuring epic spectacles, amazing TV firsts and examples of new wildlife behaviour.Série★8/10Raised by WolvesAfter Earth is ravaged by a great religious war, an atheistic android architect sends two of his creations, Mother and Father, to start a peaceful, godless colony on the planet Kepler-22b. Their treacherous task is jeopardized by the arriva…Série★8/10ColumboColumbo is a friendly, verbose, disheveled-looking police detective who is consistently underestimated by his suspects. Despite his unprepossessing appearance and apparent absentmindedness, he shrewdly solves all of his cases and secures al…Série★8/10Ray DonovanSet in the sprawling mecca of the rich and famous, Ray Donovan does the dirty work for LA's top power players, and makes their problems disappear. His father's unexpected release from prison sets off a chain of events that shakes the Donova…Série★7/10ActeursYoo Ah-inKang Young-gulShin Sae-kyeongLee Ga-youngLee Je-hoonJung Jae-hyukKwon Yu-riChoi AnnaChang Mi-heeMadam Jo Soon-heeLee Han-wiHwang Tae-sanLee Hye-sookYoon Hyang-sookYoon Ki-wonSecretary KimKoh Soo-heeYoung-gul's EmployeeRa Mi-ranYoung-gul's EmployeeRa Jae-WoongChil BokCha Seo-wonMiss Go