HEBardejovשרת הנגןvideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesBardejov2024685 דקותהסטוריהמלחמהיצא לאור11 במרץ 2024מדינהUnited States of AmericaהפקותBardejov FilmLLCGravitas VenturesThe story of Holocaust survivor Emil A. Fish, who was nine years old when he and his family in Bardejov, Slovakia were sent to a concentration camp.שחקניםSimilar vibes20 כותריםOperation ValentineShowcasing the indomitable spirits of the Indian Air Force heroes on the frontlines and the challenges they face during one of the biggest, fiercest aerial attacks that India has ever seen.סרט★5/10AsThree years after the death of her beloved child, Elouise, Mara still feels her presence when she sits on the butterfly bedding in front of the jar with her ashes in it. Mara arranges a twelfth birthday party for Elouise, further alienating…סרט★7/10A Widow's GameWhen a man is found dead, the investigation shatters his widow's perfect facade and exposes a hidden double life in this thriller based on real events.סרט★6/10Not Without My ShrinkA successful psychoanalyst's life is turned upside down by a very anxious and extremely clingy patient who starts dating his daughter.סרט★5/10Don't SleepAfter moving into a cottage together, two young lovers confront horrors of a forgotten childhood.סרט★5/10Main Tera HeroSeenu loves Sunaina but they're chased by a stalking cop, an infatuated beauty and her mafia don dad - can Seenu's heroics work?סרט★6/10Palazzina LAFCaterino is a worker at the Ilva factory in Taranto. When the company executives decide to use him as a spy to identify the workers they should get rid of, Caterino starts to track his colleagues, in search of reasons to report them. He the…סרט★7/10Dune: Part TwoFollow the mythic journey of Paul Atreides as he unites with Chani and the Fremen while on a path of revenge against the conspirators who destroyed his family. Facing a choice between the love of his life and the fate of the known universe,…סרט★8/10MonsterAfter an outburst at school involving her son, a concerned single mother demands answers, triggering a sequence of deepening suspicion and turmoil.סרט★8/10Star!Gertrude Lawrence rises to stage stardom at the cost of happiness.סרט★7/10Freaky TalesIn 1987 Oakland, a mysterious force guides The Town's underdogs in four interconnected tales: teen punks defend their turf against Nazi skinheads, a rap duo battles for hip-hop immortality, a weary henchman gets a shot at redemption, and an…סרט★6/10The Marsh King's DaughterHelena, a woman living a seemingly ordinary life, hides a dark secret—her father is the infamous 'Marsh King', the man who kept her and her mother captive in the wilderness for years. After a lifetime of trying to escape her past, Helena is…סרט★6/10ExhumaAfter tracing the origin of a disturbing supernatural affliction to a wealthy family's ancestral gravesite, a team of paranormal experts relocates the remains—and soon discovers what happens to those who dare to mess with the wrong grave.סרט★8/10RThe R of the title stands for the young protagonist, Rune, fearlessly played by Pilou Asbæk. Imprisoned for violent assault, he's a cocky, good-looking young man placed in the hardcore ward, where his survival depends on quickly learning th…סרט★7/10Out of DarknessIn the Old Stone Age, a disparate gang of early humans band together in search of a new land. But when they suspect a malevolent, mystical, being is hunting them down, the clan are forced to confront a danger they never envisaged.סרט★6/10AbigailA group of criminals kidnap a teenage ballet dancer, the daughter of a notorious gang leader, in order to obtain a ransom of $50 million, but over time, they discover that she is not just an ordinary girl. After the kidnappers begin to dimi…סרט★7/10Past LivesAfter decades apart, childhood friends Nora and Hae Sung are reunited in New York for one fateful weekend as they confront notions of destiny, love, and the choices that make a life.סרט★8/10Flora and SonSingle mom Flora is at a loss about what to do with her rebellious teenage son, Max. Her efforts to keep him out of trouble lead to a beat-up acoustic guitar, a washed-up LA musician, and harmony for this frayed Dublin family.סרט★7/10NostalgiaFelice returns to his native Rione Sanità in Naples to look after his dying mother, having lived abroad for the last forty years. Here he discovers that his old friend Oreste has become a notorious crimeboss.סרט★7/10Three FloorsFollows the lives of three families who live in a three-story building in a Roman neighbourhood.סרט★6/10