HRDizzy DishesPoslužitelj reproduktoravideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesDizzy Dishes193066 minAnimacijaKomedijaObjavljeno09. kol 1930.DržavaUnited States of AmericaProdukcijaFleischer StudiosThe Fleischer's Talkartoon short that debuted Betty Boop.Similar vibes20 naslovaBimbo's InitiationBimbo finds himself surrounded by a mysterious group of robed figures who invite him to become a member of their secret organisation. When he refuses, they fling him through a nightmarish sequence of terror and torture devices. Will our hap…Film★7/10#DoudouChallengeOn the road to her family vacation, Olivia, a 10-year old girl hooked on her phone and social media, is abandoned by her parents in a highway service area. Alone with her plushie, he tries to get her off her phone to play, but things take a…Film★6/10Law and LawlessMontana and sidekick Pancho hire on at the Lopez rancho to fight Daggett and his outlaw gang. But Lopez's foreman Barnes is one of Daggett's men and he frames Montana for murder.Film★4/10Monkey BusinessResearch chemist Barnaby Fulton works on a fountain of youth pill for a chemical company. One of the labs chimps gets loose in the laboratory and mixes chemicals, but then pours the mix into the water cooler. When trying one of his own samp…Film★7/10Funny FarmSportswriter Andy Farmer moves with his schoolteacher wife Elizabeth to the country in order to write a novel in relative seclusion. Of course, seclusion is the last thing the Farmers find in the small, eccentric town, where disaster awaits…Film★6/10The 7th Voyage of SinbadWhen a princess is shrunken by an evil wizard, Sinbad must undertake a quest to an island of monsters to cure her and prevent a war.Film★7/10Destroy All MonstersAt the turn of the century, all of the Earth's monsters have been rounded up and kept safely on Monsterland. Chaos erupts when a race of she-aliens known as the Kilaaks unleash the monsters across the world.Film★7/10Torn CurtainDuring the Cold War, an American scientist appears to defect to East Germany as part of a cloak and dagger mission to find the formula for a resin solution—but the plan goes awry when his fiancee, unaware of his motivation, follows him acro…Film★7/10The CameramanA photographer takes up newsreel shooting to impress a secretary.Film★8/10A Big Bold Beautiful JourneySarah and David are single strangers who meet at a mutual friend’s wedding and soon, through a surprising twist of fate, find themselves on a funny, fantastical, sweeping adventure together where they get to re-live important moments from t…Film★6/10The IsleMute Hee-Jin is working as a clerk in a fishing resort in the Korean wilderness; selling baits, food and occasionally her body to the fishing tourists. One day she falls in love with Hyun-Shik, who is on the run from the police, and rescues…Film★7/10Smiles of a Summer NightEarly in the 20th century, middle-aged lawyer Fredrik Egerman and his young wife, Anne, have still not consummated their marriage, while Fredrik's son finds himself increasingly attracted to his new stepmother. To make matters worse, Fredri…Film★7/10Bride of FrankensteinDr. Frankenstein and his monster both turn out to be alive after being attacked by an angry mob. The now-chastened scientist attempts to escape his past, but a former mentor forces him to assist with the creation of a new creature.Film★8/10House of WaxA sculptor opens a wax museum to showcase the likenesses of famous historical figures, but quickly runs into trouble when his business partner demands the exhibits become more extreme in order to increase profits.Film★7/10Je Tu Il ElleA woman suffers a subdued psychological breakdown in the wake of a devastating breakup.Film★7/10Jules and JimIn the carefree days before World War I, introverted Austrian author Jules strikes up a friendship with the exuberant Frenchman Jim and both men fall for the impulsive and beautiful Catherine.Film★8/10The Little Girl Who Lives Down the LaneQuiet, withdrawn 13-year-old Rynn Jacobs lives peacefully in her home in a New England beach town. Whenever the prying landlady inquires after Rynn's father, she politely claims that he's in the city on business. But when the landlady's cre…Film★7/10Exterminator 2The flamethrower-wielding vigilante John Eastland returns to rid New York of a drug lord and his gang.Film★4/10The DevilsFather Urbain Grandier’s unorthodox views of sex and religion make him a polarizing figure in 17th-century France. His outspokenness has amassed a passionate following of nuns and a respected reputation for protecting the city of Loudon fro…Film★8/10Cries and WhispersAs Agnes slowly dies of cancer, her sisters are so immersed in their own psychic pains that they are unable to offer her the support she needs.Film★8/10GlumciWilliam 'Billy' CostelloGorillaWilliam 'Billy' CostelloGus GorillaMargie HinesBetty BoopBilly MurrayBimbo