HRPoslužitelj reproduktoravideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesEnd Game2018740 minDokumentarniObjavljeno21. sij 2018.DržavaUnited States of AmericaProdukcijaSidewinder FilmsFilmed and edited in intimate vérité style, this movie follows visionary medical practitioners who are working on the cutting edge of life and death and are dedicated to changing our thinking about both.Similar vibes20 naslovaBeethoven's 3rdEveryone's favorite St. Bernard returns in this family film about man's best friend. Richard Newton, his wife Beth and kids Brennan and Sara shove off in their camper for a road trip. Along the way, they gain a new passenger: slobbery Beeth…Film★5/10A Night at the GardenArchival footage of an American Nazi rally that attracted 20,000 people at Madison Square Garden in 1939, shortly before the beginning of World War II.Film★6/10Les yeux dans les BleusThis documentary follows the French soccer team on their way to victory in the 1998 World Cup in France. Stéphane Meunier spent the whole time filming the players, the coach and some other important characters of this victory, giving us a v…Film★7/10Black SheepAfter the high-profile killing of Damilola Taylor, Cornelius' family move out of London. But when they discover their new town is run by racists, Cornelius takes a drastic step to survive.Film★7/10MargueriteAn aging woman and her nurse develop a friendship that inspires her to unearth unacknowledged longing, and thus help her make peace with her past.Film★7/10Head Over HeelsAfter many years of marriage, Walter and Madge have grown apart: He lives on the floor and she lives on the ceiling. When Walter tries to reignite their old romance, their equilibrium comes crashing down, and the couple that can’t agree whi…Film★7/10Forgive Us Our DebtsThreatened by creditors, a newly unemployed man agrees to work for a debt collector, but soon discovers his deal with the devil has unexpected costs.Film★6/10La Maison en Petits CubesLa Maison en Petits Cubes tells the story of a grandfather's memories as he adds more blocks to his house to stem the flooding waters.Film★8/10Behind the CurveMeet the growing, worldwide community of theorists who defend the belief that the Earth is flat while living in a society who vehemently rejects it.Film★6/10Good Old DazeTen years after their Upper Sixth, Bruno, Momo, Leon and Alain meet together in the waiting room of a maternity hospital. The father of the awaited baby is Tomasi, their best friend at that time, who died one month before due to an overdose…Film★7/10Fire and IceIn this animated tale, a tiny village is destroyed by a surging glacier, which serves as the deadly domain for the evil Ice Lord, Nekron. The only survivor is a young warrior, Larn, who vows to avenge this act of destruction. The evil conti…Film★7/10Searching for Sugar ManTwo South Africans set out to discover what happened to their unlikely musical hero, the mysterious 1970s rock 'n' roller, Rodriguez.Film★8/10The BarIn downtown Madrid, a series of mysterious gunshots trap a motley assortment of people in a decrepit bar.Film★6/10Free SoloFollow Alex Honnold as he attempts to become the first person to ever free solo climb Yosemite's 3,000 foot high El Capitan wall. With no ropes or safety gear, this would arguably be the greatest feat in rock climbing history.Film★8/10ShopliftersIn the outskirts of Tokyo, a poor but close-knit group living on the fringes of society survives through shoplifting and odd jobs. When Osamu and his son take in a neglected young girl, their already fragile existence begins to unravel. As …Film★8/10RomaIn 1970s Mexico City, two domestic workers help a mother of four while her husband is away for an extended period of time.Film★8/10The Intern70-year-old widower Ben Whittaker has discovered that retirement isn't all it's cracked up to be. Seizing an opportunity to get back in the game, he becomes a senior intern at an online fashion site, founded and run by Jules Ostin.Film★7/10BlacKkKlansmanColorado Springs, late 1970s. Ron Stallworth, an African American police officer, and Flip Zimmerman, his Jewish colleague, run an undercover operation to infiltrate the Ku Klux Klan.Film★7/10Five Feet ApartSeventeen-year-old Stella spends most of her time in the hospital as a cystic fibrosis patient. Her life is full of routines, boundaries and self-control — all of which get put to the test when she meets Will, an impossibly charming teen wh…Film★8/10To All the Boys I've Loved BeforeLara Jean's love life goes from imaginary to out of control when her secret letters to every boy she's ever fallen for are mysteriously mailed out.Film★8/10Glumci