HRPoslužitelj reproduktoravideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesMaaveeran20237166 minFantazijaDramaAkcijaKomedijaObjavljeno14. srp 2023.DržavaIndiaProdukcijaShanthi TalkiesAfter a head injury, cowardly newspaper cartoonist Sathya hears a voice in his mind, foretells events and puts him in precarious situations and forces him to take on a corrupt politician.Similar vibes20 naslovaJailerMuthuvel Pandian, a retired, stern yet compassionate jailer lives a peaceful life with his family, but trouble knocks his door when his cop son’s tryst with an antique mafia gang goes awry and forces Muthu to step back into a dark world he …Film★7/10Neru'Neru' is an enthralling legal and emotional drama that delves into the life of Sara, a blind sculpture artist on a quest for justice following a harrowing incident. Against the backdrop of the Indian legal system, this gripping story take…Film★7/10Satyaprem Ki KathaA middle-class boy in Ahmedabad, Satyaprem falling in one-sided love with Katha, who is coping with her breakup with Tapan. Through the journey, they discover each other's life and complement in accomplishing what was left halfway.Film★7/10VirupakshaSet in a village named Rudravanam in 1990's, Surya along with his mother, visit there after a long time. Suddenly a series of mysterious deaths occur due to an unknown person's occult practice and whole village is scared. Will Surya find th…Film★7/10Kisi Ka Bhai... Kisi Ki JaanBhaijaan, a self-defense trainer lives happily as a bachelor with his three brothers Moh, Ishq and Luv and uses violence to settle disputes. When his brothers, who’ve already found partners, come together to fix a match for him, Bhagya Laks…Film★5/10Love TodayA young couple is made to exchange their phones for a day. What follows is a hilarious and emotional sequence of events that puts their lives in misery.Film★7/10Wild DogWild Dog aka Vijay Varma is an NIA agent who’s brought back to field from a desk job to handle a terrorism case. Despite having a personal motive, he moves heaven and earth to ensure justice is served for the sake of the country.Film★6/10Waltair VeerayyaA notorious smuggler Waltair Veerayya is hired by a CI Seethapathi, reaches Malaysia with the ostensible mission of kidnapping a drug mafia leader named Solomon, who escaped India after wreaking havoc on the RAW agents and local policemen. …Film★5/10Bhaag SaaleA smart and young chap knots into a big trouble: he must defy a big time goon, to retrieve something priceless and gain back his love.Film★6/10Red LightsTwo investigators of paranormal hoaxes, the veteran Dr. Margaret Matheson and her young assistant, Tom Buckley, study the most varied metaphysical phenomena with the aim of proving their fraudulent origins. Simon Silver, a legendary blind p…Film★6/10MaestroA towering and fearless love story chronicling the lifelong relationship between Leonard Bernstein and Felicia Montealegre Cohn Bernstein. A love letter to life and art, Maestro at its core is an emotionally epic portrayal of family and lov…Film★6/10No Time to DieBond has left active service and is enjoying a tranquil life in Jamaica. His peace is short-lived when his old friend Felix Leiter from the CIA turns up asking for help. The mission to rescue a kidnapped scientist turns out to be far more t…Film★7/10Se7enTwo homicide detectives are on a desperate hunt for a serial killer whose crimes are based on the "seven deadly sins" in this dark and haunting film that takes viewers from the tortured remains of one victim to the next. The seasoned Det. S…Film★8/10OppenheimerThe story of J. Robert Oppenheimer's role in the development of the atomic bomb during World War II.Film★8/10DunePaul Atreides, a brilliant and gifted young man born into a great destiny beyond his understanding, must travel to the most dangerous planet in the universe to ensure the future of his family and his people. As malevolent forces explode int…Film★8/10Dune: Part TwoFollow the mythic journey of Paul Atreides as he unites with Chani and the Fremen while on a path of revenge against the conspirators who destroyed his family. Facing a choice between the love of his life and the fate of the known universe,…Film★8/10The Last DuelKing Charles VI declares that Knight Jean de Carrouges settle his dispute with his squire, Jacques Le Gris, by challenging him to a duel.Film★7/10Blue BeetleRecent college grad Jaime Reyes returns home full of aspirations for his future, only to find that home is not quite as he left it. As he searches to find his purpose in the world, fate intervenes when Jaime unexpectedly finds himself in po…Film★7/10The Equalizer 3Robert McCall finds himself at home in Southern Italy but he discovers his friends are under the control of local crime bosses. As events turn deadly, McCall knows what he has to do: become his friends' protector by taking on the mafia.Film★7/10The Count of Monte CristoEdmond Dantès becomes the target of a sinister plot and is arrested on his wedding day for a crime he did not commit. After 14 years in the island prison of Château d’If, he manages a daring escape. Now rich beyond his dreams, he assumes th…Film★8/10GlumciSivakarthikeyanSathya / MaaveeranAditi ShankarNilaSarithaEeshwariMysskinJeyakodiSunil VarmaParamuYogi BabuKumarMonisha BlessyRaajiDhilebanSelvamSemmalar AnnamSelviBalaji SakthivelC.MMinor YogiThannarasuMadhan Kumar DhakshinamoorthyDhanraj