HULejátszó szervervideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesLocked In2023596 percThrillerMegjelenés2023. nov. 01.OrszágokUnited Kingdom, FranceGyártásokNeon FilmsGaumontA kindly nurse tries to unlock the secrets of a coma patient's injuries — and discovers the bitter rivalry, infidelity, betrayal and murder behind them.SzereplőkFamke JanssenKatherine CarterRose WilliamsLina CarterAlex HassellDr. Robert LawrenceFinn ColeJamie CarterAnna FrielNurse Nicky MackenzieGeorgia ThorneYoung LinaToby RyanYoung JamieKarl CollinsNeurosurgeonLesley MolonyDoctorChris HallawaysFirst ArboristRachel HolifieldSecond ArboristCameron RobertsonLandlordSimilar vibes20 címHands That BindA hired hand's plans to take over his boss farm are shattered when the landowner's son returns to claim his birthright.Film★9/10Writing Around the Christmas TreeMikaela is a successful romance novelist who has had bad luck in love, visits a quaint bed and breakfast for a Christmas writer's retreat near a snowy lake town each year. Upon arriving, she meets dashing writer Levi, who soon convinces Mik…Film★5/10The War BelowDuring World War I, a group of British miners are recruited to tunnel underneath no man's land and set bombs from below the German front in hopes of breaking the deadly stalemate of the Battle of Messines.Film★7/10HambreLeni and Paul are „all good!“, as Paul likes to emphasise. But on this evening even he realises that this is not true at all. Their new neighbours, Mariam and Ayla, who come over for dinner embody exactly what Leni and Paul have not been fo…Film★7/10The AfterAfter losing a family member to a violent crime, a shattered rideshare driver picks up a passenger that forces him to confront his grief.Film★6/10Fast ColorA woman is forced to go on the run when her superhuman abilities are discovered. Years after having abandoned her family, the only place she has left to hide is home.Film★6/10Gosford ParkIn 1930s England, a group of pretentious rich and famous gather together for a weekend of relaxation at a hunting resort. But when a murder occurs, each one of these interesting characters becomes a suspect.Film★7/10JungleeA vet returns home to his father's elephant reserve where he encounters and fights an international poacher's racket.Film★7/10Jaane JaanWhen a single mother her teenage daughter becomes ensnared in a deadly crime, find an unexpected ally in their neighbor, a simple, doting but genius teacher math teacher comes to aid, while a tenacious cop digs into the case.Film★7/10The Black BookAfter his son is wrongly accused of kidnapping, a deacon who has just lost his wife takes matters into his own hands and fights a crooked police gang to clear him.Film★7/10WingwomenTired of life on the run, a pro thief decides to retire — but not before one easy last job with her partner in crime and a feisty new getaway driver.Film★6/10FerryBefore he built a drug empire, Ferry Bouman returns to his hometown on a revenge mission that finds his loyalty tested — and a love that alters his life.Film★7/10Rising HighCharting the rise and fall of three corrupt real estate agents who accumulate absurd wealth in no time but fall into a vortex of fraud, greed and drugs.Film★7/10The ChampionChristian is an extremely talented as well as unpredictable football player. After his latest screw-up, the president of his team decides to assign him a personal tutor, to help him in controlling his temper. Valerio is a shy and solitary p…Film★7/10The SwarmA single mother breeds locusts as high-protein foods but has trouble getting them to reproduce until she finds they have a taste for blood.Film★6/10The MisfitsAfter being recruited by a group of unconventional thieves, renowned criminal Richard Pace finds himself caught up in an elaborate gold heist that promises to have far-reaching implications on his life and the lives of countless others.Film★5/10Cash OutCriminal mastermind Mason is about to execute the score of a lifetime when his lover and key member of his crew, Decker, takes the team down and reveals she’s an undercover Interpol agent. Heartbroken, Mason escapes and retires from the lif…Film★6/10One Piece: The MovieThere once was a pirate known as the Great Gold Pirate Woonan, who obtained almost one-third of the world's gold. Over the course of a few years, the pirate's existence faded, and a legend grew that he disappeared with his gold to a remote …Film★7/10TerminalIn the dark heart of a sprawling, anonymous city, two assassins carry out a sinister mission, a teacher battles a fatal illness, and an enigmatic janitor and a curious waitress lead dangerous double lives. Murderous consequences unravel in…Film★6/10Dolores ClaiborneDolores Claiborne was accused of killing her abusive husband twenty years ago, but the court's findings were inconclusive and she was allowed to walk free. Now she has been accused of killing her employer, Vera Donovan, and this time there …Film★7/10