HULejátszó szervervideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesJim Jefferies: This Is Me Now2018770 percVígjátékMegjelenés2018. júl. 13.OrszágUnited States of AmericaGyártásIrwin EntertainmentThe gleefully irreverent Jefferies skewers “grabby” celebrities, political hypocrisy and his own ill-advised career moves in a brash stand-up special.Similar vibes20 címLouis C.K. 2017Louis C.K. muses on religion, eternal love, giving dogs drugs, email fights, teachers and more in a live performance from Washington, D.C.Film★7/10Jim Jefferies: FreedumbReturning for a second Netflix comedy special, Jim Jefferies unleashes his famously ferocious black humor to a packed house in Nashville, Tennessee.Film★7/10A Boyfriend for My WifeEl Tenso does not know how to face his ill-tempered wife, Tana, to tell her that he wants to separate. Carlos, a friend of Tenso, suggests him to invert the situation and cause Tana to leave him by hiring Cuervo Flores, an irresistible sedu…Film★6/10Jim Jefferies: BareSmart, crude, and in-your-face, Australian comic/actor/equal-opportunity-offender Jim Jefferies is not for the faint of heart. Whether he is lampooning gun control, auditioning disabled actors, or over-sharing sexual experiences, the FXX "L…Film★8/10Mike Birbiglia: Thank God for JokesMike Birbiglia declares that a joke should never end with "I’m joking." In his all-new comedy, Birbiglia tiptoes hilariously through the minefield that is modern-day joke-telling. Join Mike as he learns that the same jokes that elicit laugh…Film★7/10Le Cercle RougeWhen French criminal Corey gets released from prison, he resolves to never return. He is quickly pulled back into the underworld, however, after a chance encounter with escaped murderer Vogel. Along with former policeman and current alcohol…Film★8/10Jim Jefferies: AlcoholocaustShare this *Alcoholocaust: (Meaning: The aftermath of a drinking party, usually resulting in every available horizontal surface being covered in empty booze containers, spilled beverages and a general sticky alcoholic residue.) Jim Jefferie…Film★7/10Jim Jefferies: ContrabandLast year’s critically acclaimed show ‘30’ sold out every night at the Edinburgh Festival and his UK and US tours. From those tours, Jeffries, the controversial Aussie stand-up, brings you his debut DVD, Contraband Live. Succeeding with jok…Film★8/10Judah Friedlander: America Is the Greatest Country in the United StatesDeadpan comic and self-proclaimed world champion Judah Friedlander performs over several nights in New York, explaining why America is No. 1.Film★7/10HeartstopperA physician who was hanged during the American Revolution for being a vampire is resurrected. He confesses his crimes to a priest, but starts to kill again. His modern descendant turns out to be a serial killer who also wants to be a vampir…Film★5/10The NegotiationAn ace crisis negotiator attempts to figure out the real motivation of a man who has kidnapped two people and crack his calm demeanour.Film★7/10MankindA restless young man wants to leave love and the Earth behind.Film★4/10BloodRayneIn 18th-century Romania, after spending much of her life in a traveling circus, human-vampire hybrid Rayne escapes and plots to take down her father, Kagan, the evil vampire king. When she's discovered by three vampire hunters, she manages …Film★4/10DudeFour best friends negotiate loss and major life changes during the last two weeks of high school.Film★6/10The Night BeforeIn New York City for their annual tradition of Christmas Eve debauchery, three lifelong best friends set out to find the Holy Grail of Christmas parties since their yearly reunion might be coming to an end.Film★6/10Valerian and the City of a Thousand PlanetsIn the 28th century, Valerian and Laureline are special operatives charged with keeping order throughout the human territories. On assignment from the Minister of Defense, the two undertake a mission to Alpha, an ever-expanding metropolis w…Film★7/10Zathura: A Space AdventureAfter their father is called into work, two young boys, Walter and Danny, are left in the care of their teenage sister, Lisa, and told they must stay inside. Walter and Danny, who anticipate a boring day, are shocked when they begin playing…Film★6/10Pitch BlackWhen their ship crash-lands on a remote planet, the marooned passengers soon learn that escaped convict Riddick isn't the only thing they have to fear. Deadly creatures lurk in the shadows, waiting to attack in the dark, and the planet is r…Film★7/10Ghost in the ShellIn the year 2029, the barriers of our world have been broken down by the net and by cybernetics, but this brings new vulnerability to humans in the form of brain-hacking. When a highly-wanted hacker known as 'The Puppetmaster' begins involv…Film★8/10Bridget Jones's DiaryBridget Jones is an average woman struggling against expectations. As a New Year's resolution, Bridget decides to take control of her life, starting by keeping a diary in which she will always tell the complete truth. Her charming boss take…Film★7/10SzereplőkJim JefferiesHimself