IDServer pemutarvideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesRe-Kill2015687 mntKengerianCerita FiksiRilis16 Okt 2015NegaraUnited States of AmericaProduksiAfter Dark FilmsSignature PicturesMidsummer FilmsFive years after a zombie outbreak, the men and women of R-Division hunt down and destroy the undead. When they see signs of a second outbreak, they fear humanity may not survive.PemeranRoger CrossSargeBruce PayneWinstonScott AdkinsParkerDaniella AlonsoMatthewsJesse GarcíaHernandezDimiter Doichinov"Grizzly" AdamsYo SanthaveesukNyguyenLayke AndersonTom FalkirkRocky MarshallLangfordStuart MilliganCaptain McadamHenry GarrettRedneckOwen DavisBobby Camera GuySimilar vibes19 judul...Watch Out, We're MadEstranged, quarreling brothers Carezza and Sorriso have to put aside their differences to reclaim their father's beloved dune buggy from predatory real estate developer Torsillo, with the help of beautiful circus performer Miriam, whose fam…Film★6/10Re-AnimatorConducting clandestine experiments within the morgue at Miskatonic University, scientist Herbert West reveals to a fellow graduate student his groundbreaking work concerning the re-animation of fresh corpses.Film★7/10Beyond Re-AnimatorOnce again tampering with mother nature to disastrous results, Dr. Herbert West continues his research while serving time in a maximum security prison for his previous exploits. West's limited prison-cell experiments are suddenly interrupte…Film★6/10Night of the Living Dead: Re-AnimationAfter inheriting the family mortuary, a pyrophobic mortician accidentally exposes hundreds of un-cremated bodies to toxic medical waste. As the corpses re-animate, the mortician's inheritance-seeking younger brother unexpectantly shows up, …Film★6/10Re-CutKetika gadis kembar ditemukan tewas di gudang keluarga mereka, bintang realitas yang berubah menjadi reporter TV Meredith Phillips dan kru kameranya dikirim ke pedesaan Wisconsin untuk menyelidiki kematian mengerikan itu. Dalam dorongan tan…Film★7/10Bride of Re-AnimatorUnperturbed by the disastrous outcome of his previous meddling with the dead, Dr. West continues his research into the phenomenon of re-animation; only this time, he plans to create life – starting with the heart of his young protégé Dan's …Film★6/10Re-ElectedFriends battle former U.S. presidents when they come back from the dead as zombies on the Fourth of July.Film★7/10EscapeTen years after the Black Death devastated the country, a poor family sets out on a journey to search for better living conditions. In a deserted mountain pass, they are attacked by a gang of ruthless killer thieves. The only one spared is …Film★6/10Sanam ReA story about the man who is confused with his love life finds solace in his birthplace with his childhood love.Film★6/10The Four SeasonsThree middle-aged wealthy couples take vacations together in Spring, Summer, Autumn and Winter. Along the way we are treated to mid-life, marital, parental and other crises.Film★6/10VANishThree thugs kidnap Emma, the daughter of a drug kingpin, and have no idea that murderous blood that runs through her veins. As time passes, the unlucky threesome finds themselves in danger from the police, gangsters and their captive.Film★5/10WWE Battleground 2016Battleground (2016) is an upcoming professional wrestling pay-per-view (PPV) event and WWE Network event produced by WWE. It will take place on July 24, 2016 at the Verizon Center in Washington, D.C. It will be the fourth event under the Ba…Film★6/10I Love You, StupidMarcos' life turns upside down after he loses the same day his girlfriend and his job. Marcos' life turns wild after to meet Raquel.Film★6/10The Human Centipede 3 (Final Sequence)Mengambil inspirasi dari film The Human Centipede, sipir penjara yang terkenal dan bermasalah berusaha menciptakan kelabang manusia berkapasitas 500 orang sebagai solusi untuk masalahnya.Film★4/10Oedipus RexIn pre-war Italy, a young couple have a baby boy. The father, however, is jealous of his son - and the scene moves to antiquity, where the baby is taken into the desert to be killed. He is rescued, given the name Oedipus, and brought up by …Film★7/10We're the MillersA veteran pot dealer creates a fake family as part of his plan to move a huge shipment of weed into the U.S. from Mexico.Film★7/10Zero Dark ThirtyA chronicle of the decade-long hunt for al-Qaeda terrorist leader Osama bin Laden after the September 2001 attacks, and his death at the hands of the Navy S.E.A.L. Team 6 in May, 2011.Film★7/10OppenheimerKisah peran J. Robert Oppenheimer dalam pengembangan bom atom selama Perang Dunia II.Film★8/10JokerPada tahun 1980-an, seorang komedian stand‑up gagal terjebak dalam kegilaan dan beralih ke kehidupan kriminal dan kekacauan di Kota Gotham, menjadi figur kejahatan psikopat yang terkenal.Film★8/10