IDServer pemutarvideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesGod's Not Dead20146113 mntDramaRilis21 Mar 2014NegaraUnited States of AmericaProduksiPure Flix EntertainmentGreg Jenkins ProductionsRed Entertainment GroupAfter he refuses to disavow his faith, a devout Christian student must prove the existence of God or else his college philosophy professor will fail him.PemeranKevin SorboProfessor RadissonShane HarperJosh WheatonDavid A.R. WhiteReverend DaveDean CainMark ShelleyCassidy GiffordKaraMarco KhanMirsabAlex AristidisFahidWillie RobertsonWillie RobertsonKorie RobertsonKorie RobertsonHadeel SittuAyishaPaul KwoMartin YipTrisha LaFacheAmy RyanSimilar vibes20 judulGod's Not Dead 2When a high school teacher is asked a question in class about Jesus, her reasoned response lands her in deep trouble and could expel God from the public square once and for all.Film★6/10God's Not Dead: A Light in DarknessPastor Dave responds to the unimaginable tragedy of having his church, located on the grounds of the local university, burned down.Film★7/10Let There Be LightAn atheist goes through a near-death experience in an auto accident before converting to Christianity.Film★6/10Jim Jefferies: I Swear to GodJim Jefferies: I Swear to God: The easily offended might do best to avoid Jim Jefferies’ raunchy, rude humor (or at least imbibe the two-drink minimum beforehand), but the Australian-born comedian provides plenty of laughs for everyone else…Film★7/10The StagAt his fiancée’s urging, a very modern Irish groom-to-be reluctantly agrees to a stag weekend with his friends, camping in the western wilderness of Ireland. Much to their chagrin, these modern men are joined by the brother of the bride, a …Film★6/10Deep in the DarknessDr. Michael Cayle thought leaving the chaotic lifestyle of New York City behind for the quiet, small town of Ashborough would bring his family closer together. Soon after arriving, however, he discovers the town's deepest secret: a terrifyi…Film★5/10The EncounterWhen five strangers with nothing in common come together at a remote roadside eatery, they place their orders with the diner's omniscient owner, who seems to know everything about them ... and is eerily reminiscent of Jesus Christ.Film★6/10The Ultimate LifeDespite his best intentions, billionaire Jason Stevens can’t find enough time to keep his beloved Alexia a priority. But when he discovers his late grandfather’s journal, he is transported back to Red Stevens’ incredible world. With everyth…Film★7/10InstakillerWhen a woman's teenage daughter becomes internet famous, she becomes worried about the amount of attention her daughter is receiving. Her fears prove justified when she realizes someone is stalking her daughter.Film★7/10Wicked BloodHannah and Amber Baker are trapped in a dark Southern underworld of violence, drugs and bikers. Both live in fear of their "Uncle Frank" Stinson, the ruthless leader of a crime organization.Film★6/10Waffle StreetThe true story of Jimmy Adams, a V.P. of a $30 billion hedge fund, who loses his job and winds up working as a waiter at a waffle shop. Amidst the greasy madness of the 24-hour diner, Jimmy befriends Edward, an ex-con grill master who serve…Film★6/1020812081 depicts a dystopian future in which, thanks to the 212th Amendment to the Constitution and the unceasing vigilance of the United States Handicapper General, everyone is "finally equal...." The strong wear weights, the beautiful wear ma…Film★6/10BrennanBased on the life of author, war veteran, one-time franciscan priest and unconventional evangelist Brennan Manning. A stranger agrees to give Brennan a ride home to New Orleans in order to save his marriage.Film★10/10Augustine: The Decline of the Roman EmpireAugustine is a two-part, Italian-made mini-series about the influential theologian and church father Augustine of Hippo. The piece tells the story of his life from a teenager to his death at the age of 69.Much of the content for the scenes …Film★5/10The Greatest GiftThe last sequence of a Western is ready to be shot. In the blink of an eye, the Director modifies the classical happy ending, because revenge is not happy - and it is never the end of the conflict. He travels the world, horseback riding, se…Film★7/10The Pastor's WifeBased on the true story of Matthew Winkler, a beloved minister who, in 2006, was found shot and killed in his Selmer, Tennessee home, his wife and young daughters missing. Authorities soon zeroed in on Matthew's wife, Mary, as the prime sus…Film★6/10Sweet InspirationsAfter finding out that an abused women’s shelter is losing funding, a group of determined ladies form a bakery in hopes to raise the money before it’s too late.Film★5/10Oil for the Lamps of ChinaAn American oil company representative risks sacrificing his marriage for his career in the rural lands of China.Film★7/10Dance-OffTwo cross-town rival dance teams go head to head for the National Nationals Championship.Film★6/10The Trip to BountifulCarrie Watts begrudgingly lives with her busy, overprotective son, Ludie and pretentious daughter-in-law, Jessie Mae. No longer able to drive and forbidden to travel alone, she wishes for freedom from the confines of the house.Film★6/10