IDSertâniaServer pemutarvideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesSertânia2020997 mntDramaSejarahBaratRilis26 Jan 2020NegaraBrazilProduksiCariri FilmesWhen bandits take the town of Sertânia, Antão gets shot, arrested, and left to die. Bleeding out, Antão's delirious mind begins to recall the events that led up to the incident through a sequence of increasingly unreliable fever dreams.Similar vibes20 judulThe Old GuardFour undying warriors who've secretly protected humanity for centuries become targeted for their mysterious powers just as they discover a new immortal.Film★7/10The Year My Parents Went on VacationA boy is left alone in a Jewish neighborhood in the year of 1970, where both world cup and dictatorship happen in Brazil.Film★7/10Watching the Pain of OthersIn this deeply personal video diary, a young researcher tries to make sense of her fascination for the film "The Pain of Others" by Penny Lane. A deep dive into the discomforting world of YouTube and online conspiracies, that challenges tra…Film★9/10OppenheimerThe story of J. Robert Oppenheimer's role in the development of the atomic bomb during World War II.Film★8/10Titanic101-year-old Rose DeWitt Bukater tells the story of her life aboard the Titanic, 84 years later. A young Rose boards the ship with her mother and fiancé. Meanwhile, Jack Dawson and Fabrizio De Rossi win third-class tickets aboard the ship. …Film★8/10JokerDuring the 1980s, a failed stand-up comedian is driven insane and turns to a life of crime and chaos in Gotham City while becoming an infamous psychopathic crime figure.Film★8/10Darkman II: The Return of DurantDarkman and Durant return and they hate each other as much as ever. This time, Durant has plans to take over the city's drug trade using high-tech weaponry. Darkman must step in and try to stop Durant once and for all.Film★6/108 MileFor Jimmy Smith, Jr., life is a daily fight just to keep hope alive. Feeding his dreams in Detroit's vibrant music scene, Jimmy wages an extraordinary personal struggle to find his own voice - and earn a place in a world where rhymes rule, …Film★7/10Back to the FutureEighties teenager Marty McFly is accidentally sent back in time to 1955, inadvertently disrupting his parents' first meeting and attracting his mother's romantic interest. Marty must repair the damage to history by rekindling his parents' r…Film★8/10ExtractionA hardened gun-for-hire's latest mission becomes a soul-searching race to survive when he's sent into Bangladesh to rescue a drug lord's kidnapped son.Film★7/10Toy Story 4Woody has always been confident about his place in the world and that his priority is taking care of his kid, whether that's Andy or Bonnie. But when Bonnie adds a reluctant new toy called "Forky" to her room, a road trip adventure alongsid…Film★7/10SoulJoe Gardner is a middle school teacher with a love for jazz music. After a successful audition at the Half Note Club, he suddenly gets into an accident that separates his soul from his body and is transported to the You Seminar, a center in…Film★8/10Eden LakeWhen a young couple goes to a remote wooded lake for a romantic getaway, their quiet weekend is shattered by an aggressive group of local kids. Rowdiness quickly turns to rage as the teens terrorize the couple in unimaginable ways, and a we…Film★7/10Once Upon a Time... in HollywoodLos Angeles, 1969. TV star Rick Dalton, a struggling actor specializing in westerns, and stuntman Cliff Booth, his best friend, try to survive in a constantly changing movie industry. Dalton is the neighbor of the young and promising actres…Film★7/10The Suicide SquadSupervillains Harley Quinn, Bloodsport, Peacemaker and a collection of nutty cons at Belle Reve prison join the super-secret, super-shady Task Force X as they are dropped off at the remote, enemy-infused island of Corto Maltese.Film★7/10The CollectorDesperate to repay his debt to his ex-wife, an ex-con plots a heist at his new employer's country home, unaware that a second criminal has also targeted the property, and rigged it with a series of deadly traps.Film★7/10The Importance of Being EarnestTwo young gentlemen living in 1890s England use the same pseudonym ('Ernest') on the sly, which is fine until they both fall in love with women using that name, which leads to a comedy of mistaken identities.Film★7/10CoralineWandering her rambling old house in her boring new town, 11-year-old Coraline discovers a hidden door to a strangely idealized version of her life. In order to stay in the fantasy, she must make a frighteningly real sacrifice.Film★8/10Boss LevelA former special forces agent is trapped in a time loop and relives his death over and over again. To escape the terrible situation, he must track down those responsible and stop them.Film★7/10Hocus PocusAfter 300 years of slumber, three sister witches are accidentally resurrected in Salem on Halloween night, and it is up to three kids and their newfound feline friend to put an end to the witches' reign of terror once and for all.Film★7/10PemeranVertin MouraAntão / GaviãoJulio AdriãoCapitão Jesuíno / Pai de AntãoKecia PradoMãe de AntãoLourinelson VladmirDelmiro Gouveia / Major Sólon / Coronel MilitãoIgor de CarvalhoNeblinaHenzo Gabriel M. VieiraAntão criançaGilsergio BotelhoSeu Filó / Padre ColombêEdgard NavarroAntonio ConselheiroSara GalvãoDona SantinhaIsa MeiDona MocinhaFernando NevesDr. QueirozMarcelo CordeiroJoão Velho / Cel. Tiburcio