IDServer pemutarvideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesI.S.S.2024696 mntCerita SeruCerita FiksiRilis19 Jan 2024NegaraUnited States of AmericaProduksiLD EntertainmentTensions flare in the near future aboard the International Space Station as a conflict breaks out on Earth. U.S. and Russian astronauts receive orders from the ground: take control of the station by any means necessary.PemeranAriana DeBoseDr. Kira FosterChris MessinaGordon BarrettJohn Gallagher Jr.Christian CampbellMasha MashkovaWeronika VetrovCosta RoninNicholai PulovPilou AsbækAlexey PulovSimilar vibes20 judulS.O.S. TitanicThe Titanic disaster as seen through the eyes of one couple in each of the three classes on board.Film★6/10The SeedingWhen a hiker gets lost in the desert, a gang of feral children propelled by haunting legacies traps him in a sadistic battle for survival with a frightening endgame.Film★5/10Popeye the Sailor Meets Sindbad the SailorAfter wrecking Popeye's ship and stealing away Olive Oyl, hero of Arabic legend Sindbad decides to test him and his ever-resilient new rival's strength in order to prove their supremacy as the "most remarkable, extraordinary fella" of Sindb…Film★7/10Dark Angel: The AscentA bored female demon ventures to the surface world to punish the wicked before they enter her hellish domain.Film★5/10Alive and TickingEva lives a happy life with her father, an unsuccessful but always optimistic car salesman, her consumerist mother, and her quirky grandmother. But Eva is a tad different - she suffers from Tourette's syndrome. Her family has long been ac…Film★6/10Lily & KatSet in New York City, the film follows a naive fashion school graduate named Lily who finds her world turned upside down when her reckless best friend Kat announces she’s moving away to London in a matter of days. At a Lower East Side art o…Film★4/10Ernest Cole: Lost and FoundMore than 60,000 of Ernest Cole’s 35mm film negatives were inexplicably discovered in a bank vault in Stockholm, Sweden. Most considered these forever lost, especially the thousands of pictures he shot in the U.S. Told through Cole’s own wr…Film★8/10Rock It, Stone Fish!Zhanna returns from Moscow to the city of her childhood, having learned that her father is dying. She did not communicate with him for the last 20 years after he left his family. Zhanna does not have time to catch him alive and plans to ret…Film★7/10Left Behind: Rise of the AntichristAfter millions of people vanish and the world falls into chaos, a charismatic leader rises to lead the UN. However, his intentions are more sinister than they appear.Film★5/10Our SeasonBok-ja diberikan liburan khusus setelah kematiannya, yang memungkinkan dia untuk pergi menemui putrinya, Jin-joo, seorang profesor universitas yang tinggal di luar negeri. Tidak seperti ekspektasinya, Bok-ja menemukan Jin-joo tinggal di rum…Film★9/10Out of ExileRecently paroled thief Gabriel Russell tries to balance his life and mend a troubled family as an FBI agent hunts him down, along with his crew after a botched armored car robbery.Film★6/10EscapeA young man becomes convinced that the solution to all his problems is to live in jail, and he will do whatever it takes to get it.Film★5/10Deep FearA solo trip aboard a yacht takes a terrifying turn when a woman encounters three drug traffickers clinging to the shattered remains of a boat. They soon force her to dive into shark-infested waters to retrieve kilos of cocaine from the sunk…Film★5/10FrenchmenThe life of four best friends in Paris: Antoine (a gym school teacher), Jeff (director of a monthly journal), Alex (Jeff's associate in the monthly journal and a Don Juan) and Manu (owner of fine food store). Their time is shared between th…Film★6/10What You Wish ForA talented chef with gambling woes flees to a Latin American villa to visit an old friend who appears to be living an extraordinary life as a private chef. Envy soon turns to greed and then to something deeply unsettling for the chef when h…Film★7/10Valley of ShadowsQuique, Clara and little Lucas are vacationing in northern India. One night, sleeping outside during a storm, they are brutally attacked. Hours later, Quique is rescued by a native and taken to a remote isolated village in the mountains.Film★6/10One True LovesEmma and Jesse are living the perfect life together, until Jesse disappears in a tragic helicopter crash on their first wedding anniversary. Four years later, Emma has found happiness again and is about to marry her best friend when Jesse r…Film★6/10The American Society of Magical NegroesA young man, Aren, is recruited into a secret society of magical Black people who dedicate their lives to a cause of utmost importance: making white people’s lives easier.Film★5/10Don't Look at the DemonA spiritual medium leads a paranormal investigative TV crew to a haunted home only to discover that the evil spirit she’s facing holds the key to her troubled past.Film★7/10OutsideSebuah keluarga mengungsi ke perkebunan terpencil selama wabah zombi, tetapi rahasia-rahasia lama nan menyakitkan membebani saat mereka menjalani dunia yang terisolasi.Film★6/10