ITYou Ought to Be in PicturesServer del playervideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesYou Ought to Be in Pictures1940710 minAnimazioneCommediaUscita18 mag 1940PaeseUnited States of AmericaProduzioniLeon Schlesinger ProductionsWarner Bros. PicturesDaffy Duck convinces Porky Pig to quit the cartoon biz and try his luck in the features. Porky's adventures begin when he tries to enter the studio.Similar vibes19 titoliA Day at the BeachThe whole family is at the beach for an outing, and each is having their own little adventure. The Captain fights the sun with his beach umbrella, in an attempt to nap. Grandpa tries to build a sand castle, but the waves keep wiping it out.…Film★6/10Bimbo's InitiationBimbo finds himself surrounded by a mysterious group of robed figures who invite him to become a member of their secret organisation. When he refuses, they fling him through a nightmarish sequence of terror and torture devices. Will our hap…Film★7/10Donald's Dream VoiceDonald is trying to sell brushes door-to-door, but since nobody can understand him, nobody will buy anything. He happens across a street vendor selling voice pills. They work great, but he's only got a limited number so of course, the last …Film★6/10Porky's Baseball BroadcastPorky Pig provides play-by-play radio-broadcast commentary during a World Series baseball game.Film★5/10Decalogue VIIIZofia, a professor of ethics, is visited by Elżbieta, an American researching the fate of Jews who survived World War II. A daytime classroom conversation turns into a night of confrontation, and Zofia is forced to answer for a decision she…Film★7/10Re-GeneratorA plane containing a highly classified government project crashes outside of a small town in the US. Realizing the level of danger, the government tries to secretly fix the problem. As tensions grow, the situation gets out of control, and c…Film★6/10Bill Burr Presents: Friends Who KillIn a night of killer comedy, Bill Burr hosts a showcase of his most raucous stand-up comic pals as they riff on everything from COVID to Michael Jackson.Film★5/10The Return of La LloronaLa Llorona, a supernatural being who seeks revenge for the death of her daughters, attacks a group of young people on vacation at the beach after they accidentally kill a young girl.Film★6/10Dabangg 2Chulbul Pandey invites a fresh trouble when he kills the brother of a notorious politician and the former swears to wreak havoc in his life.Film★5/10The Marriage of Maria BraunMaria marries a young soldier in the last days of World War II, only for him to go missing in the war. She must rely on her beauty and ambition to navigate the difficult post-war years alone.Film★7/10QwertyConglomerated Assets, a brokerage firm is sinking fast as its CEO checks out and leaves the company to his inept film school drop out son. Enter Quincy, Waverly, Erica, Rudy, Tina and Yasmine. Team QWERTY--six sexy secretaries that must sav…Film★6/10Dracula: Prince of DarknessWhilst vacationing in the Carpathian Mountain, two couples stumble across the remains of Count Dracula's castle. The Count's trusted servant kills one of the men, suspending the body over the Count's ashes so that the blood drips from the c…Film★7/10Mutiny on the BusesBus driver Stan Butler agrees to marry Suzy, much to the anguish of Mum, her son-in-law, Arthur, and daughter Olive. How, they wonder, will they ever manage without Stan's money coming in? Then Arthur is sacked, and Stan agrees to delay the…Film★7/10Singam 2Picking up the storyline from where Singam ended, Duraisingam has gone undercover after meeting the Home Minister and is working as an NCC officer in a school in Thoothukudi. The only people who know about this operation are the Chief Minis…Film★6/10The Vampire LoversIn the heart of Styria the Karnstein Family, even after their mortal deaths, rise from their tombs spreading evil in the countryside in their lust for fresh blood. Baron Hartog whose family are all victims of Karnstein vampirism, opens thei…Film★6/10Hellraiser: HellseekerWhen the puzzle box is once again solved, Pinhead and his legion demolish all who dare oppose them. But standing in his way is the only person who has defeated Cenobites of the past.Film★5/10The Way to the HeartAva, an award-winning chef at a big-city restaurant, has lost her spark. Her boss sends her out to find herself to save her menu and her job. She returns home and finds little to inspire her, but when she reunites with her childhood friend …Film★10/10Hey Qween - Holigay SpecialLet’s get SICK’NING for the Holidays! RuPaul’s Drag Race legend Laganja Estanja is here for Hey Qween’s Very Green Christmas Special!Film★5/10My Sister and ICarlo is a responsible sibling who deals with his black-sheep sister Silvia in this situation comedy. When Silvia returns after many years to attend her mother's funeral, Carlo deals with the fallout caused by her many love affairs. Carlo i…Film★6/10AttoriMel BlancPorky Pig / Daffy Duck / Additional Voices (voice) (uncredited)Leon SchlesingerSelfHenry BinderStagehand (uncredited)Gerry ChiniquyMovie Director (uncredited)Robert ClampettGuy Running Out at Super Speed (archive footage) (uncredited)Chuck JonesGuy Running Out at Super Speed (archive footage) (uncredited)Michael MalteseStudio Guard (uncredited)Fred JonesAnimator (uncredited)