ITServer del playervideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesBong of the Dead2011391 minHorrorAzioneCommediaUscita04 feb 2011PaeseCanadaProduzioneMind In Motion ProductionsWhen the world is taken over by flesh eating zombies, best friends Tommy and Edwin figure out a way to benefit from it by turning zombies into fertilizer for growing potent weed! There will be bud.Similar vibes20 titoliThe TripperA Ronald Reagan-obsessed serial killer targets a bunch of hippies who are heading to a weekend-long concert.Film★5/10MadFilm★7/10Persian PicklesA swimming study of paisley patterns traces this decorative motif from its origins in Persian weavings to appearances Irish quilting and American Counterculture. Extending on the stroboscopic tradition of anti-animation, this short material…Film★6/10WCW SuperBrawl IVRic Flair goes toe-to-toe against Vader for the WCW World Heavyweight Championship inside the Thundercage. Sting, Brian Pillman & Dustin Rhodes join forces to take on "Stunning" Steve Austin, Rick Rude & Paul Orndorff inside the Thundercage…Film★5/10White RoomA man wakes up in an endless white void, unable to remember how he got there, he soon encounters an A.I. who takes the man through old memories of himself until he realizes his tragic purpose in the white room.Film★10/10Cirkusrevyen 2024This year's Cirkusrevy has it all: show, fun, satire, and stars who can make it all float effortlessly," wrote Berlingske's reviewer about Cirkusrevyen 2024, which once again this year serves up satire, parodies, and a fast-paced show with …Film★7/10Transmorphers: Mech Beasts20 years after the events of Transmorphers, a newer, more advanced species of alien robot descends on a rebuilt Earth, threatening once again to destroy the planet.Film★6/10The Day The Earth Nearly DiedSome 250 million years ago, all but five per cent of life on Earth was wiped out in the greatest disaster our planet has ever experienced, yet the cause of this event has long remained a mystery. Palaeontologists in Greenland explain the an…Film★7/10Palkó CsinomThe musical adventure film goes back to the early eighteenth century, the times of the battles between the Hungarian insurrectionists and the pro-Austrians. Palkó and Jankó are about to join the insurrectionist army when they clash with a p…Film★7/10KasparKaspar is drowning. Several people who want to save him rush forward. Some of them are filled with good will, others are pumped up with pretentiousness. They are all equally inefficient in this satirical animated film about public spiritedn…Film★6/10Everton: Howard's WayAfter a decade of struggle and misfortune Everton became the best side in the land. Even better than their all-conquering neighbours, Liverpool! They won the FA Cup, thrashed Man Utd 5-0, beat Liverpool, home and away, and then strolled to …Film★6/10National FamilyDon Poli, the patriarch of a family embedded in politics, faces the change of party in his state - after a hundred years in power - losing all his privileges. Humiliated and angry, he threatens to disinherit his family and leave to rebuild …Film★7/10Untitled SlasherA short film completely made in the span of five days. The story follows a boy named Leonidas. After finding his grandfather dead, Leonidas must survive while a killer is loose in his home.Film★9/10ReplayWhen François' wife Cecile was leaving him because of his affairs with other women, she had an auto accident. In this drama, he makes uses of her amnesia to try to win her back and misleads her at every turn in her quest to recover her memo…Film★6/10HashepsalachFilm★8/10SurrenderT. Griffin Sanders is a successful high-stakes real estate developer willing to risk everything but his heart until, during an unexpected delay in his otherwise manic schedule, he is caught in a wide-awake daydream in which his conscience g…Film★5/10IntentA policewoman tries to stop a serial killer focusing on lesbian couples.Film★2/10ShonddhikkhonGIGABYTE presents Shonddhikkhon. Directed by Yasir Arafat Rahim. Starring Farhan Ahmed Jovan and Introducing Malaika Chowdhury. Enjoy the full drama. Drama Name: Shonddhikkhon Story: Mehazabien Chowdhury Cast: Farhan Ahmed Jovan, Malaika Ch…Film★10/10Wait PleaseA wonderfully touching tale about loveFilm★5/10DuneSounds as witnesses. They blurr into memories, half-dreams, it is undecided if they are real or not. A fluctuation between imagination and reality.Film★7/10AttoriSimone BaillyLeahJy HarrisTommyMark SweatmanEdwinBarry NerlingAlexVince LaxtonVictorAllan KiplingWoodsmanCher StaiteMarthaScott FraserFlashback Zombie#1Tony LanghornFlashback ZombieRoy WhyteFlashback ZombieScott FraserFlashback ZombieLea CoffmanNews Anchor Woman