LTFaces of Death IIGrotuvo serverisvideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesFaces of Death II1981478 minSiauboDokumentiniaiIšleido1981-05-01ŠalisUnited States of AmericaProdukcijosF.O.D. ProductionsGorgon VideoBrief scenes of death related material: mortuaries, accidents and police work are filmed by TV crews and home video cameras. Some of it is most likely fake, some not as much.AktoriaiMichael CarrDr. Francis B. GrössJohn Hinckley Jr.Self (archive footage)Similar vibes20 pavadinimaiFaces of Death IIIThe third installment of the infamous "is it real or fake?" mondo series sets its sights primarily on serial killers, with lengthy reenactments of police investigations of bodies being found in dumpsters, and a staged courtroom sequence.Filmas★4/10The Worst of Faces of DeathIncludes many disturbing highlights from the first three Faces of Death films, such as animal slaughtering, executions, and more.Filmas★4/10Raganaitės 2Raganaitės – dvynės! Jos susitinka po dvidešimt vienerių metų ir dabar dviguba jėga kovos su blogiu!Filmas★7/10Nepaprasti Šarpėjos nuotykiaiŠarpe Evans iškeliauja į Niujorką pradėti karjeros Brodvėjuje, tačiau viskas ne taip lengva kaip atrodo.Filmas★6/10The ReturnThe Return is a 2016 documentary directed by Emmy Award winning director Erich Joiner chronicling Ford GT's return to 24 Hours of Le Mans after their 1966 1-2-3 victory.Filmas★7/10Return to Christmas CreekAs Christmas approaches, Amelia Hughes, a career-focused Chicago app developer lacking in holiday spirit, returns to her small hometown of Christmas Creek to rediscover the meaning of Christmas. There, she reunites with her childhood best f…Filmas★6/10Didžiosios motušės namai: Obuolys nuo obels...Pirmose dviejose filmo dalyse meistriškai maskavęsis ir savo gyvybe vardan nusikaltėlių išaiškinimo rizikavęs Malcolmas, žada ne prastesnį maskavimosi šou ir gardžią juoko dozę ir trečiojoje komedijos Didžiosios motušės namai dalyje. FTB ag…Filmas★6/10Return to MayberryAfter being away for awhile, Andy Taylor returns home to Mayberry to visit Opie, now an expectant father. While there he ends up helping Barney Fife mount a campaign for sheriff.Filmas★6/10Return to HomsFilmed over 3 years in Homs, accompanying 2 outstanding young men from the time they were only dreaming of freedom to the time when they are forced to change course. Basset, the 19yo national football team goalkeeper, who became an outspoke…Filmas★7/10The Stranger's ReturnA divorcée leaves New York to visit her grandfather's farm and recover in the Midwest, where she unexpectedly falls in love with a married farmer.Filmas★6/10Ozo legendos: Sugrįžimas į Smaragdo miestąŠiuolaikiškai pateikta, naujais personažais ir įvykiais papildyta animacijos juosta pagal Lymano Franko Baumo „Ozo šalies burtininko“ istoriją nukels didelius ir mažus į stebuklingą šalį, kur herojai gaus svarbių draugystės pamokų. Praūžus …Filmas★6/10St Trinian's 2: The Legend of Fritton's GoldAfter a wealthy philanthropist expresses an unusual interest in a ring found by her niece Annabelle, Miss Fritton explains that she's descended from a pirate who, in 1598, stole treasure from another: the philanthropist's ancestor. This dis…Filmas★6/10The Little Mermaid: Ariel's BeginningFollow Ariel's adventures before she gave up her fins for true love. When Ariel wasn't singing with her sisters, she spent time with her mother, Queen Athena. Ariel is devastated when Athena is killed by pirates, and after King Triton outla…Filmas★7/10PandaTwo teenagers are playing by night in a dirty parking lot. After they are driving on an empty road, they start to tease each other on the way to the sea, but they seem to be too young to drive and the road is a bit strange.Filmas★7/10Darkman II: The Return of DurantDarkman and Durant return and they hate each other as much as ever. This time, Durant has plans to take over the city's drug trade using high-tech weaponry. Darkman must step in and try to stop Durant once and for all.Filmas★6/10Lemtingas posūkis 5Mažame miestelyje vyksta Helovyno šventė. Žmonės apsirengę siaubingais kostiumais ir nusiteikę linksmai praleisti laiką. Tačiau kanibalų šeimynėlė nutraukia jų linksmybes, kai apsilanko pas grupelę studentų.Filmas★5/10The Cheetah Girls: One WorldChanel, Dorinda, and Aqua are off to India to star in a Bollywood movie. But when they discover that they will have to compete against each other to get the role in the movie, will the Cheetahs break up again?Filmas★6/10Įrašas 4Iš užkrėsto pastato Barselonoje išgelbėta televizijos laidų reporterė Angela yra nugabenama į tanklaivį tyrimams atlikti. Iš pirmo žvilgsnio ten dirbantiems mokslininkams jos tyrimai pasirodo normalūs ir niekuo neišsiskiriantys, tačiau jie …Filmas★6/10Transformers: Titans ReturnAfter the Combiner Wars ended, Cybertron started to be rebuilt. However, an undead Starscream has been reincarnated as Trypticon, wreaking havoc around him. To combat this menace, Windblade gathers up a ragtag team of Transformers, includin…Filmas★7/10Aladinas 2: Džafaro sugrįžimasPo pirmojo filmo įvykių Aladinas mėgaujasi gyvenimu rūmuose su princese Jasmine ir ruošiasi tapti sultono didžiuoju vizieriumi. Tačiau netrukus jis vėl priverstas susidurti su gudriu burtininku Jafaru, kuris, padedamas plėšikų gaujos lyderi…Filmas★6/10