LTLet Me Make You a MartyrGrotuvo serverisvideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesLet Me Make You a Martyr20165101 minMaginė fantastikaDramosVeiksmoTrileriaiKriminaliniaiMistiniaiIšleido2016-07-22ŠalisUnited States of AmericaProdukcijaActium PicturesA cerebral revenge film about two adopted siblings who fall in love, and hatch a plan to kill their abusive father.AktoriaiMarilyn MansonPopeNiko NicoteraDrew GlassSam QuartinJune GlassMark Boone JuniorLarry GlassMichael PottsCharonRebekah KennedyLibbySimilar vibes20 pavadinimaiThe ClientA street-wise kid, Mark Sway, sees the suicide of Jerome Clifford, a prominent Louisiana lawyer, whose current client is Barry 'The Blade' Muldano, a Mafia hit-man. Before Jerome shoots himself, he tells Mark where the body of a Senator is …Filmas★7/10Blood FatherAn ex-con reunites with his estranged wayward 16-year old daughter to protect her from drug dealers who are trying to kill her.Filmas★6/10The Lodgers1920, rural Ireland. Anglo-Irish twins Rachel and Edward share a strange existence in their crumbling family estate. Each night, the property becomes the domain of a sinister presence (The Lodgers) which enforces three rules upon the twins:…Filmas★5/10The BirdsThousands of birds flock into a seaside town and terrorize the residents in a series of deadly attacks.Filmas★8/10SkyfallWhen Bond's latest assignment goes gravely wrong, agents around the world are exposed and MI6 headquarters is attacked. While M faces challenges to her authority and position from Gareth Mallory, the new Chairman of the Intelligence and Sec…Filmas★7/10John WickEx-hitman John Wick comes out of retirement to track down the gangsters that took everything from him.Filmas★7/10AvatarIn the 22nd century, a paraplegic Marine is dispatched to the moon Pandora on a unique mission, but becomes torn between following orders and protecting an alien civilization.Filmas★8/10OppenheimerThe story of J. Robert Oppenheimer's role in the development of the atomic bomb during World War II.Filmas★8/10Pulp FictionA burger-loving hit man, his philosophical partner, a drug-addled gangster's moll and a washed-up boxer converge in this sprawling, comedic crime caper. Their adventures unfurl in three stories that ingeniously trip back and forth in time.Filmas★8/10Batman BeginsDriven by tragedy, billionaire Bruce Wayne dedicates his life to uncovering and defeating the corruption that plagues his home, Gotham City. Unable to work within the system, he instead creates a new identity, a symbol of fear for the crim…Filmas★8/10The Shawshank RedemptionImprisoned in the 1940s for the double murder of his wife and her lover, upstanding banker Andy Dufresne begins a new life at the Shawshank prison, where he puts his accounting skills to work for an amoral warden. During his long stretch in…Filmas★9/10Django UnchainedWith the help of a German bounty hunter, a freed slave sets out to rescue his wife from a brutal Mississippi plantation owner.Filmas★8/10The AvengersWhen an unexpected enemy emerges and threatens global safety and security, Nick Fury, director of the international peacekeeping agency known as S.H.I.E.L.D., finds himself in need of a team to pull the world back from the brink of disaster…Filmas★8/10Hidden FiguresThe untold story of Katherine G. Johnson, Dorothy Vaughan and Mary Jackson – brilliant African-American women working at NASA and serving as the brains behind one of the greatest operations in history – the launch of astronaut John Glenn in…Filmas★8/10Forrest GumpA man with a low IQ has accomplished great things in his life and been present during significant historic events—in each case, far exceeding what anyone imagined he could do. But despite all he has achieved, his one true love eludes him.Filmas★8/10InceptionCobb, a skilled thief who commits corporate espionage by infiltrating the subconscious of his targets is offered a chance to regain his old life as payment for a task considered to be impossible: "inception", the implantation of another per…Filmas★8/1012 Angry MenThe defense and the prosecution have rested and the jury is filing into the jury room to decide if a young Spanish-American is guilty or innocent of murdering his father. What begins as an open and shut case soon becomes a mini-drama of eac…Filmas★9/10Inside OutWhen 11-year-old Riley moves to a new city, her Emotions team up to help her through the transition. Joy, Fear, Anger, Disgust and Sadness work together, but when Joy and Sadness get lost, they must journey through unfamiliar places to get …Filmas★8/10Gone GirlWith his wife's disappearance having become the focus of an intense media circus, a man sees the spotlight turned on him when it's suspected that he may not be innocent.Filmas★8/10JokerDuring the 1980s, a failed stand-up comedian is driven insane and turns to a life of crime and chaos in Gotham City while becoming an infamous psychopathic crime figure.Filmas★8/10