LTGrotuvo serverisvideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesNo Escape Room2018686 minSiauboTrileriaiMistiniaiTeleviziniai filmaiIšleido2018-10-06ŠalisUnited States of AmericaProdukcijaMarVista EntertainmentA father and daughter check out a small town escape room and discover there is something sinister about the place.AktoriaiJeni RossKarenMark GhaniméMichaelHamza HaqTylerKathryn DavisMelanieDennis AndresAndrewBrianna BarnesJosieKate HurmanBetsyAlana BlaireLady in the WaterJad SaikaliRotting CorpseSimilar vibes20 pavadinimaiKarmaWhen recent college grad Manny has trouble making ends meet, his father-in-law offers him a job evicting delinquent tenants. Manny soon finds himself unleashing a karma demon which stalks him at every turn.Filmas★6/10Head CountNewcomer Evan joins a group of teens on a getaway in Joshua Tree. While exchanging ghost stories around the campfire, Evan reads aloud a mysterious chant from an internet site. From that moment, someone--or something--is among them.Filmas★5/10Stage FrightA high-end musical theater camp is terrorized by a bloodthirsty killer who hates musical theater.Filmas★5/10Flesh DreamAfter the death of their friend, two students discover a disturbing website that murders anyone that ventures too far into its domain.Filmas★8/10Creature FeatureCreature Feature is five interwoven tales of terror that occur one foggy Halloween night in Georgia. A babysitter learns a new appreciation for fine art and hard lesson about the consequences of being irresponsible...and naughty!; a group o…Filmas★3/10UnexpectedAn inner-city high school teacher discovers she is pregnant at the same time as one of her most promising students and the two develop an unlikely friendship while struggling to navigate their unexpected pregnancies.Filmas★6/10Sudden FearActor Lester Blaine has all but landed the lead in Myra Hudson's new play when Myra vetoes him because, to her, he doesn't look like a romantic leading man. On a train from New York to San Francisco, Blaine sets out to prove Myra wrong...by…Filmas★7/10CaptiveA teenage runaway who’s trapped by a delusional man, pretends to be his daughter in order to escape.Filmas★7/10NailsParalyzed after a terrible accident, Dana struggles to regain her life and family when she encounters a malevolent ghost in her hospital room.Filmas★6/10The Field Guide to EvilA feature-length anthology film. They are known as myths, lore, and folktales. Created to give logic to mankind’s darkest fears, these stories laid the foundation for what we now know as the horror genre.Filmas★6/10Escape RoomFour friends who partake in a popular Los Angeles escape room find themselves stuck with a demonically possessed killer. They have less than an hour to solve the puzzles needed to escape the room alive.Filmas★5/10TraumaFour friends visit a rural locality of Chile, are brutally attacked by a man and his son. After not finding help in the town, they decide to confront these men with the help of a pair of policemen. But in this way, they will discover that t…Filmas★5/10Play or DieWelcome to Paranoia, the ultimate escape game. Rule #1: Nothing is real. Rule #2: One of you will die. Lucas and Chloe, two passionate gamers, decide to participate to Paranoia, a very exclusive escape game. After solving a first riddle, th…Filmas★5/10ButchersSadistų mėsininkų šeima gyvena giliai užmiestyje. Nuo žiemos iki vasaros šunų dienų kiekvienas, kuris kerta jų kelią, yra negyva mėsa.Filmas★5/10The Late BloomerA sex therapist goes through puberty after the successful removal of a benign tumor resting against his pituitary gland. He experiences all the changes and effects of puberty over a three-week period.Filmas★5/10ExistsA group of friends venture into the remote Texas woods for a party weekend and find themselves stalked by Bigfoot.Filmas★6/10GirlA young woman returns to her small hometown intent on killing her abusive father only to discover someone murdered him the day before. As the girl searches for answers, she uncovers a family legacy more dangerous than she'd imagined.Filmas★6/10Survive the NightA disgraced doctor and his family are held hostage at their home by criminals on the run, when a robbery-gone-awry requires them to seek immediate medical attention.Filmas★5/10Caught by a WaveA summer fling born under the Sicilian sun quickly develops into a heartbreaking love story that forces a boy and girl to grow up too quickly.Filmas★7/10AdmissionStraitlaced Princeton University admissions officer Portia Nathan is caught off-guard when she makes a recruiting visit to an alternative high school overseen by her former classmate, the freewheeling John Pressman. Pressman has surmised th…Filmas★6/10