NLSpeler-server111moviesvideasyvidsrcvidfastvidlinkvidnestmoviesapiAflevering123456Seizoen1234Channel Zero20167DramaUitgebracht11 okt 2016LandVerenigde StatenCreatorNick AntoscaProductiesUCPEat the CatA horror anthology series inspired by “Creepypasta” online tales.Similar vibes20 titelsOdd Mom OutAcclaimed author Jill Kargman plays a version of herself as she navigates the treacherous and elite ecosystem of New York's Upper East Side, and the uber-wealthy mommy clique inhabiting this fantastically outrageous domain.Serie★6/10A Black Lady Sketch ShowA narrative series set in a limitless magical reality full of dynamic, hilarious characters and celebrity guests presenting sketches performed by a core cast of black women.Serie★7/10Real DetectiveWith narrative driven exclusively by the detectives themselves, each episode ventures deep into the mind of a homicide detective as they describe in vivid detail the one case forever ingrained in their memory.Serie★8/10ClassCoal Hill School has been a feature of Doctor Who since the first episode, but now we get to see the day-to-day adventures of the students coping with intrusions from space and time.Serie★6/10Life with LouieThe 8-year-old Louie is doing his best to grow up and cope with a large family, a doting mother, a pesky little brother, and a by-the-book, military veteran dad. Add to that a slew of holiday family squabbles, a flood, an old Rambler and a …Serie★7/10Dave ChappelleComedy icon Dave Chappelle makes his triumphant return to the screen with a pair of blistering, fresh stand-up specials.Serie★7/10Mobile Suit Gundam 0083: Stardust MemoryIt is the year 0083 of the Universal Century. The rebellious Principality of Zeon has been defeated in the One Year War by the Earth Federation. However, a faction of Zeon remnants led by Aguille Delaz fled from the final battle, hiding the…Serie★8/10DamienAfter discovering his origins, Damien Thorn must cope with life as the Anti-Christ.Serie★6/10Black SpotIn the small bordertown of Villefranche, lost in the heart of a large forest, crime rate is six times higher than elsewhere in the area. Each new crime Major Laurène Weiss solves with the help of her unusual team makes her sink deeper and d…Serie★7/10Comedians in Cars Getting CoffeeJerry takes his comedy pals out for coffee in a selection of his classic automobiles. Larry David sums it up best when he says, 'You've finally made a show about nothing.'Serie★7/10Be Cool, Scooby-Doo!The gang decide to go traveling in the Mystery Machine, seeking fun and adventure during what could possibly be their last summer break together. However, havoc-wreaking monsters seem to be drawn to them, appearing almost every stop of the …Serie★8/10A HauntingThese are the true stories of the innocent and the unimaginable. Based on true events, A Haunting dramatises some of the scariest stories, revealing a world in which tragedy, suicide and murder have left psychic impressions so powerful that…Serie★7/10PowersTwo homicide detectives, Christian Walker and Deena Pilgrim, are assigned to investigate cases involving people with superhuman abilities, referred to as “Powers.” Set amidst today’s paparazzi culture, Powers asks the questions, what if the…Serie★7/10Rage of BahamutTwo thousand years ago, the black-and-silver-winged dragon, Bahamut, terrorized the magical land of Mistarcia. The humans, god, and demons that inhabited the land united forces against the fiend and sealed its power into a key which was spl…Serie★8/10AuroraHaving been cryogenically frozen for 20 years, Aurora's heart torn between past and present : memories of an old love and chance of a new one.Serie★7/10FrequencyDetective Raimy Sullivan is stunned when a voice suddenly crackles through her father’s old, long-broken ham radio – it’s Frank Sullivan, somehow transmitting over the airwaves and through the decades from 1996. Separated by twenty years, f…Serie★7/1021 Jump Street21 Jump Street revolves around a group of young cops who would use their youthful appearance to go undercover and solve crimes involving teenagers and young adults.Serie★7/10Midnight, TexasWelcome to a place where being normal is really quite strange. In a remote Texas town no one is who they seem. From vampires and witches to psychics and hit men, Midnight is a mysterious safe haven for those who are different. As the town m…Serie★7/10DominionBased on characters from the hit theatrical film ‘Legion’ (2010), ‘Dominion’ is an epic supernatural drama set in the year 25 A.E. In this transformed post–apocalyptic future an army of lower angels, assembled by the archangel Gabriel, has …Serie★7/10Call the MidwifeDrama following the lives of a group of midwives working in the poverty-stricken East End of London during the 1950s, based on the best-selling memoirs of Jennifer Worth.Serie★7/10