PLQI XSSerwer odtwarzaczavideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesOdcinek123456Sezon12QI XS20209KomediaTalkPremiera10 lis 2020KrajWielka BrytaniaProdukcjaFremantleA selection of experiments and demonstrations from recent series. Sandi Toksvig tries to maintain discipline while Alan Davies and their guests run riot.AktorzySandi ToksvigPresenterAlan DaviesGuestSimilar vibes20 tytułówMotor MythbustersIn our quest to separate fact from fiction, MythBusters has put hundreds of cars through extreme tests in the search for truth. We've gone from debunking extreme Hollywood car stunts to cooking steaks under the hood... and we've barely scra…Serial★9/10CSI: Crime Scene InvestigationA Las Vegas team of forensic investigators are trained to solve criminal cases by scouring the crime scene, collecting irrefutable evidence and finding the missing pieces that solve the mystery.Serial★8/10The King of QueensLife’s good for deliveryman Doug Heffernan, until his newly widowed father-in-law, Arthur, moves in with him and his wife Carrie. Doug is no longer the king of his domain, and instead of having a big screen television in his recently renova…Serial★7/10MarsThe maiden crew of the Daedalus spacecraft must push itself to the brink of human capability in order to successfully establish the first sustainable colony on Mars. Set both in the future and in the present day, this series blends scripted…Serial★7/10YellowstoneFollow the violent world of the Dutton family, who controls the largest contiguous ranch in the United States. Led by their patriarch John Dutton, the family defends their property against constant attack by land developers, an Indian reser…Serial★8/10The BorgiasSet in 15th century Italy at the height of the Renaissance, The Borgias chronicles the corrupt rise of patriarch Rodrigo Borgia to the papacy, where he proceeds to commit every sin in the book to amass and retain power, influence and enormo…Serial★8/10Ray DonovanSet in the sprawling mecca of the rich and famous, Ray Donovan does the dirty work for LA's top power players, and makes their problems disappear. His father's unexpected release from prison sets off a chain of events that shakes the Donova…Serial★7/1011.22.63An English teacher travels back in time to prevent the Kennedy assassination, but discovers he is attached to the life he has made in a bygone era.Serial★8/10Knight RiderMichael Long, an undercover police officer, is shot while investigating a case and left for dead by his assailants. He is rescued by Wilton Knight, a wealthy, dying millionaire and inventor who arranges life-saving surgery, including a new …Serial★8/10Star Wars: Skeleton CrewFour ordinary kids search for their home planet after getting lost in the Star Wars galaxy.Serial★7/10Mad MenSet in 1960-1970 New York, this sexy, stylized and provocative drama follows the lives of the ruthlessly competitive men and women of Madison Avenue advertising.Serial★8/10To the LakeA grim drama that unfolds against the backdrop of a global catastrophe. An unknown new virus turns Moscow into a city of the dead. Money loses its value and those not yet infected struggle desperately for food and survival.Serial★7/10VeraA sharp detective with a messy life, DCI Vera Stanhope patrols her “patch” of northeast England, pursuing the truth in cases of murder, kidnapping, and blackmail. Vera is obsessive about her work and faces the world with caustic wit, guile …Serial★7/10Baby ReindeerWhen a struggling comedian shows one act of kindness to a vulnerable woman, it sparks a suffocating obsession which threatens to wreck both their lives.Serial★8/10Shades of BlueSexy New York detective and single mother Harlee Santos fell in with a tight-knit group of dirty cops, taking bribes and protection money that she uses to provide the best life for her honest, talented daughter. But when she's trapped by th…Serial★7/10LutherA dark psychological crime drama starring Idris Elba as Luther, a man struggling with his own terrible demons, who might be as dangerous as the depraved murderers he hunts.Serial★8/10HomelandCIA officer Carrie Mathison is tops in her field despite being bipolar, which makes her volatile and unpredictable. With the help of her long-time mentor Saul Berenson, Carrie fearlessly risks everything, including her personal well-being a…Serial★8/10SeinfeldA stand-up comedian and his three offbeat friends weather the pitfalls and payoffs of life in New York City in the '90s. It's a show about nothing.Serial★8/10The OfficeNightmare boss. Tedious colleagues. Pointless tasks. Welcome to Wernham Hogg. Fancy a tea break with David Brent? Classic comedy from the archive.Serial★8/10ChernobylThe true story of one of the worst man-made catastrophes in history: the catastrophic nuclear accident at Chernobyl. A tale of the brave men and women who sacrificed to save Europe from unimaginable disaster.Serial★9/10