PT-BRServidor do playervideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesPelé: Birth of a Legend20167107 minDramaLançamento06 de mai. de 2016PaísUnited States of AmericaProduçõesZohar InternationalImagine EntertainmentSeine PicturesZohar CinemaAll Rise FilmsThe life story of Brazilian football legend, Pele.AtoresKevin de PaulaPeléLeonardo Lima CarvalhoYounger PeléSeu JorgeDondinhoMilton GonçalvesWaldemar de BritoSeth MichaelsMárioVincent D'OnofrioFeolaAndré MattosSantos club's coachMariana NunesCeleste ArantesPhil MilerNarrator (voice)Rafael HenriquesYuri (14 year old)Felipe SimasGarrinchaAdriano AragonFrench Announcer (voice)Similar vibes20 títulosMetroRoper, a hostage negotiator catches a murderous bank robber after a blown heist. The bank robber escapes and immediately goes after the man who put him behind bars.Filme★6/10Recep IvedikA man finds the wallet of a rich man and takes a rigorous trip in an old car to return it, finding an old love and a new life of luxury awaiting.Filme★5/10Queen of EarthTwo women retreat to a lake house to get a break from the pressures of the outside world, only to realize how disconnected from each other they have become, allowing their suspicions to bleed into reality.Filme★6/10AceAsso (Ace), the best poker-player in town, was killed in his wedding night, because he won too much against a bad loser. In the "final" game in heaven the clerk on duty also lost, so Asso can come back to this world as a ghost to search for…Filme★6/10None Like UsThe imperfections of love and its bitter consequences in Turin, Italy, during the ‘80s, before the social networks and smartphones. What happens to your heart when you discover that you're madly in love with your best friend? What happens t…Filme★6/10Ritorno al crimineFilme★6/10Maria Montessori: una vita per i bambiniThe story of Maria Montessori the most famous pedagogue of the world. She spent all her life to make her "metodo" (method) accepted in the archaic Italian school system, while the rest of the world immediately understand the importance of h…Filme★7/10Vita, Cuore, BattitoEnzo and Monica, two engaged thirty-year-olds from the outskirts of Naples, lead a life of routine until Enzo makes a sharp bet at the illegal lottery, thanks to which he wins a trip offered up for grabs by the criminal who runs the game. T…Filme★6/10Fast ConvoyMálaga, southern Spain. Seven men, divided into four cars, set off with a large drug shipment towards Creil, a city near Paris; a routine mission that will be complicated by a fatal sequence of events.Filme★6/10The Canterville GhostIn the depths of a British legend, the ghost of Eleanor Canterville is condemned to haunt the castle of his family and to scare away any inhabitant. It fulfills this task perfectly, helped by Gwilherm, his faithful servant. But when Otis, a…Filme★6/10The IdolMohammed Assaf, an aspiring musician living in Gaza, sets a seemingly impossible goal: to compete on the program "Arab Idol."Filme★7/10The Book of SunIn 2010, at the peak of the Saudi YouTube movement, high school senior Husam finds himself drawn into the world of video production. He’s joined in his pursuit by his best friend Maan, their one-time foe Ibrahim, and Orabi a teacher with a …Filme★8/10Bad RoomiesTwo guys find a beautiful young woman to take the place of their missing roommate. Everything seems fine until a horrible mistake on drunken night leads all three on a downward spiral.Filme★5/10Marine Life InterviewsInterviews with the animals at the Marine Life Institute about their experiences with Dory.Filme★6/10A Nasty Piece of WorkA mid-level corporate employee finds out he’s not getting the Christmas bonus he was expecting, but his boss invites him to earn a promotion by beating his professional rival in a violent competition.Filme★7/10MaradonapoliDiego Maradona is one of the best football player ever. An important moment of his life is the passage to the italian soccer team, Napoli.Filme★6/10TradedIn the 1880s western "Traded", a father must leave his ranch for Dodge City to save his daughter from an old enemy, putting his reputation as the fastest draw in the west to the test.Filme★5/10Dirty WarAfter years of meticulous planning, a terrorist operation is reaching its final stages. The authorities have received no intelligence; they are in a race against time but don't yet know it. As the operation unfolds, we see the working lives…Filme★6/10Maradona, the Hand of GodDramatizing of the many shocking highs and lows of Argentine soccer hero Diego Maradona, an extraordinary athlete and arguably the greatest player in the history of the sport.Filme★6/10My Sister's Kids Home AloneThis time, the children's parents have gone on vacation to New York, and it is up to Uncle Erik to take responsibility for his nephews and nieces, or at least try to. Everything seems to be going well, until Jan and Michael take a little dr…Filme★6/10