PT-BRLosing GroundServidor do playervideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesLosing Ground1982686 minDramaComédiaLançamento02 de jun. de 1982PaísUnited States of AmericaProduçãoMilestone Film & VideoSara, a cold college professor, and her husband, an ecstatic painter, spend a summer away from the city, straining their rocky relationship.Similar vibes20 títulosElevator to the GallowsA self-assured businessman murders his employer, husband of his mistress, which unintentionally provokes an ill-fated chain of events.Filme★8/10SertâniaWhen bandits take the town of Sertânia, Antão gets shot, arrested, and left to die. Bleeding out, Antão's delirious mind begins to recall the events that led up to the incident through a sequence of increasingly unreliable fever dreams.Filme★9/10RushIn the 1970s, a rivalry propels race car drivers Niki Lauda and James Hunt to fame and glory — until a horrible accident threatens to end it all.Filme★8/10Inside OutWhen 11-year-old Riley moves to a new city, her Emotions team up to help her through the transition. Joy, Fear, Anger, Disgust and Sadness work together, but when Joy and Sadness get lost, they must journey through unfamiliar places to get …Filme★8/10Titanic101-year-old Rose DeWitt Bukater tells the story of her life aboard the Titanic, 84 years later. A young Rose boards the ship with her mother and fiancé. Meanwhile, Jack Dawson and Fabrizio De Rossi win third-class tickets aboard the ship. …Filme★8/102 Fast 2 FuriousIt's a major double-cross when former police officer Brian O'Conner teams up with his ex-con buddy Roman Pearce to transport a shipment of "dirty" money for shady Miami-based import-export dealer Carter Verone. But the guys are actually wor…Filme★7/10Ex MachinaCaleb, a coder at the world's largest internet company, wins a competition to spend a week at a private mountain retreat belonging to Nathan, the reclusive CEO of the company. But when Caleb arrives at the remote location he finds that he w…Filme★8/10Black MassThe true story of Whitey Bulger, the brother of a state senator and the most infamous violent criminal in the history of South Boston, who became an FBI informant to take down a Mafia family invading his turf.Filme★7/10American SniperU.S. Navy SEAL Chris Kyle takes his sole mission—protect his comrades—to heart and becomes one of the most lethal snipers in American history. His pinpoint accuracy not only saves countless lives but also makes him a prime target of insurge…Filme★7/10PKA stranger in the city asks questions no one has asked before. Known only by his initials, the man's innocent questions and childlike curiosity take him on a journey of love, laughter and letting go.Filme★8/10Jurassic WorldTwenty-two years after the events of Jurassic Park, Isla Nublar now features a fully functioning dinosaur theme park, Jurassic World, as originally envisioned by John Hammond.Filme★7/10Mean GirlsCady Heron is a hit with The Plastics, the A-list girl clique at her new school, until she makes the mistake of falling for Aaron Samuels, the ex-boyfriend of alpha Plastic Regina George.Filme★7/10Friends with BenefitsDylan is done with relationships. Jamie decides to stop buying into the Hollywood clichés of true love. When the two become friends they decide to try something new and take advantage of their mutual attraction - but without any emotional a…Filme★7/10Shutter IslandWorld War II soldier-turned-U.S. Marshal Teddy Daniels investigates the disappearance of a patient from a hospital for the criminally insane, but his efforts are compromised by troubling visions and a mysterious doctor.Filme★8/10DivergentIn a world divided into factions based on personality types, Tris learns that she's been classified as Divergent and won't fit in. When she discovers a plot to destroy Divergents, Tris and the mysterious Four must find out what makes Diverg…Filme★7/10Eden LakeWhen a young couple goes to a remote wooded lake for a romantic getaway, their quiet weekend is shattered by an aggressive group of local kids. Rowdiness quickly turns to rage as the teens terrorize the couple in unimaginable ways, and a we…Filme★7/10GiftedFrank, a single man raising his child prodigy niece Mary, is drawn into a custody battle with his mother.Filme★8/10It Boy38-year-old Alice has everything to become the next editor-in-chief of Rebelle magazine except for her uptight image. But when the young and charming Balthazar, barely 20, crosses Alice's path, she realizes that he holds the key to her prom…Filme★7/10Rise of the Planet of the ApesA highly intelligent chimpanzee named Caesar has been living a peaceful suburban life ever since he was born. But when he gets taken to a cruel primate facility, Caesar decides to revolt against those who have harmed him.Filme★7/10SoulJoe Gardner is a middle school teacher with a love for jazz music. After a successful audition at the Half Note Club, he suddenly gets into an accident that separates his soul from his body and is transported to the You Seminar, a center in…Filme★8/10AtoresSeret ScottSaraBill GunnVictorDuane JonesDukeMaritza RiveraCeliaBillie AllenMotherGary BollingGeorgeMaureen GradyFemale Student in OfficeClarence Branch Jr.Man on RadioJoe GarciaOther Student in Class