PT-BRServidor do playervideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesWar Pigs2015592 minAçãoGuerraLançamento03 de ago. de 2015PaísUnited States of AmericaProduçõesSchuetzle Company ProductionsVMI WorldwideVerdi ProductionsThe FyzzA rag tag unit of misfits known as the War Pigs must go behind enemy lines to exterminate Nazis by any means necessary.Similar vibes20 títulosLet It SnowSeparated from her fiance after sneaking onto a restricted slope, Mia, a free riding snowboarder, must survive not only against nature, but the masked snowmobile rider in black who's out for her blood.Filme★5/10The Last FrontierThe story of the Podolsk cadets’ heroic stand outside Moscow in October 1941. Cadets were sent to the Ilyinsky line, fighting alongside units from the Soviet 43rd Army to hold back the German advance until reinforcements arrived. Hopelessly…Filme★7/10We Were YoungFive long-term pals confront ageing and mortality as they enjoy their last weeks together before taking different paths.Filme★6/10ForsakenJohn Henry returns to his hometown in hopes of repairing his relationship with his estranged father, but a local gang is terrorizing the town. John Henry is the only one who can stop them, however he has abandoned both his gun and reputatio…Filme★6/10The Great WarIn November of 1918 as World War I was ending, a unit of American soldiers goes behind enemy lines to find a lost platoon of African American soldiers.Filme★7/10Gone Fishin'Two fishing fanatics get in trouble when their fishing boat gets stolen while on a trip.Filme★5/10Gagarin: First in SpaceThe film is dedicated to the first steps of mankind on the path of space exploration and direct the fate of the first cosmonaut Yuri Gagarin. The main motif - the fight for the right to be first: the competition in the first cosmonaut, comp…Filme★6/10Rhymes for Young GhoulsIn 1976, a Mi'gMaq teenager plots revenge against the sadistic Indian agent who imprisoned her in a residential school where rape and abuse are common.Filme★7/10Street WarsWhen Officer Elijah Kane and his team of undercover cops discover a new lab drug flooding through the nightclubs of Seattle, they struggle to eliminate it from the streets immediately. As if dealing with a dozen dead ravers isn't enough, th…Filme★6/1050 Ways to Leave Your Lovers after an earthquake convince Owen, a writer of hack "as told to" autobiographies, to leave L.A. He burns his bridges telling people what he really thinks, quits his current client (a randy astronaut), and heads for the airport. Waiting fo…Filme★4/10Sweet VirginiaA former rodeo star, now a motel manager, meets a young man who is responsible for the violence that suddenly has seized his small town.Filme★6/10Hyena RoadThree different men, three different worlds, three different wars – all stand at the intersection of modern warfare – a murky world of fluid morality where all is not as it seems. A unique and dramatic look at the Canadian Army in Afghanist…Filme★7/10Rurouni Kenshin: The BeginningBefore he was a protector, Kenshin was a fearsome assassin known as Battosai. But when he meets gentle Tomoe Yukishiro, a beautiful young woman who carries a huge burden in her heart, his life will change forever.Filme★8/10Secret in Their EyesA tight-knit team of FBI investigators, along with their District Attorney supervisor, is suddenly torn apart when they discover that one of their own teenage daughters has been brutally murdered.Filme★6/10Bone TomahawkDuring a shootout in a saloon, Sheriff Hunt injures a suspicious stranger. The doctor's assistant, wife of the local foreman, tends to him in prison. That night, the town is attacked and they both disappear—only the arrow of a cannibal trib…Filme★7/10The Wolf's CallShown from the perspective of a young submariner with unusually sensitive hearing and uncannily precise sound recognition. The fate of many often depends on his ability, and one time, whilst highly stressed, he makes a incorrect call which …Filme★8/10The Man from U.N.C.L.E.At the height of the Cold War, a mysterious criminal organization plans to use nuclear weapons and technology to upset the fragile balance of power between the United States and Soviet Union. CIA agent Napoleon Solo and KGB agent Illya Kury…Filme★7/10Mission: Impossible - Rogue NationEthan and team take on their most impossible mission yet—eradicating 'The Syndicate', an International and highly-skilled rogue organization committed to destroying the IMF.Filme★7/10San AndreasIn the aftermath of a massive earthquake in California, a rescue-chopper pilot makes a dangerous journey across the state in order to rescue his estranged daughter.Filme★6/10American SniperU.S. Navy SEAL Chris Kyle takes his sole mission—protect his comrades—to heart and becomes one of the most lethal snipers in American history. His pinpoint accuracy not only saves countless lives but also makes him a prime target of insurge…Filme★7/10AtoresLuke GossCaptain Jack WosickDolph LundgrenCaptain Hans PicaultChuck LiddellSergeant McGreevyNoah SeganAugust ChambersSteven LukePreacherMickey RourkeMajor A.J. ReddingRyan KelleyWilliam YorkAngie PapanikolasTemptressJake StormoenFrenchy BuckleK.C. ClydeMoffatePaul Cram