PT-PTAvalanche SharksServidor do playervideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesAvalanche Sharks2012382 minAventuraTerrorAçãoComédiaFicção científicaEstreia12/01/2012PaísesCanada, United States of AmericaProduçõesOdyssey MediaPulser ProductionsRogue StateThe CartelA snow avalanche awakens humungous, prehistoric sharks that proceed to chomp on bikini clad co-eds.Similar vibes20 títulosBig Ass Spider!When a giant alien spider escapes from a military lab and rampages across the city of Los Angeles, it is up to one clever exterminator and his security guard sidekick to kill the creature before the entire city is destroyed.Filme★6/103-Headed Shark AttackThe world’s greatest killing machine is three times as deadly, when a mutated shark threatens a cruise ship. As the shark eats its way from one end of the ship to the next, the passengers fight the deadly predator using anything they can fi…Filme★4/10The Super InframanThe surface of the Earth is under attack, thousands of people are killed in this unprovoked attacked. The cause, Princess Dragonmon and her army of monsters have decided to invade. Princess Dragonmon is an alien whose race has been hiding u…Filme★6/10Assassin's BulletIn Assassin's Bullet, Slater plays Robert Diggs, a black ops agent who comes to work for Ambassador Ashdown (Hunger Games star Donald Sutherland), tracking down a vigilante assassin in Eastern Europe. The maverick hit(wo)man has been taking…Filme★4/10Blade: The Iron CrossWhen the malevolent Dr. Hauser, the Third Reich's maddest scientist, rises again with murder and mayhem on his mind, psychic journalist Elisa Ivanov awakens her own angel of death in Blade.Filme★4/10Unabomber: The True StoryThe real story behind the hunt for Theodore J. Kaczynski, later known as the Unabomber, a terrorist who sent several bombs through the mail, alarming authorities and society. The movie follows a postal inspector who tracks down the suspect;…Filme★6/10Feast of DeathA documentary about James Ellroy and his fascination with unsolved murder cases, especially those of his mother, and the similar, infamous, Black Dahlia murder.Filme★6/10CampingPlastic surgeon Michel Saint-Josse is on his way to Spain where he hopes to spend a stress-free holiday in a luxury hotel with his teenage daughter Vanessa. When his car breaks down near a camping, Michel accepts the offer of help from an e…Filme★6/10Captive StateNearly a decade after occupation by an extraterrestrial force, the lives of a Chicago neighborhood on both sides of the conflict are explored. In a working-class Chicago neighborhood occupied by an alien force for nine years, increased surv…Filme★6/10The Wizards Return: Alex vs. AlexWhile trying to prove to her family she can be mature and responsible, teen wizard Alex Russo conjures up a spell to rid herself of her bad qualities, unintentionally creating a Good and Evil Alex. When Evil Alex gets involved in a plan to …Filme★8/10Guns AkimboAn ordinary guy suddenly finds himself forced to fight a gladiator-like battle for a dark website that streams the violence for viewers. In order to survive and rescue his kidnapped ex-girlfriend, he must battle Nix, a heavily armed and muc…Filme★6/10Warm BodiesAfter a zombie becomes involved with the girlfriend of one of his victims, their romance sets in motion a sequence of events that might transform the entire lifeless world.Filme★6/10BarbieBarbie and Ken are having the time of their lives in the colorful and seemingly perfect world of Barbie Land. However, when they get a chance to go to the real world, they soon discover the joys and perils of living among humans.Filme★7/10Ex MachinaCaleb, a coder at the world's largest internet company, wins a competition to spend a week at a private mountain retreat belonging to Nathan, the reclusive CEO of the company. But when Caleb arrives at the remote location he finds that he w…Filme★8/10John WickEx-hitman John Wick comes out of retirement to track down the gangsters that took everything from him.Filme★7/10Blue BeetleRecent college grad Jaime Reyes returns home full of aspirations for his future, only to find that home is not quite as he left it. As he searches to find his purpose in the world, fate intervenes when Jaime unexpectedly finds himself in po…Filme★7/10PKA stranger in the city asks questions no one has asked before. Known only by his initials, the man's innocent questions and childlike curiosity take him on a journey of love, laughter and letting go.Filme★8/10Harry Potter and the Philosopher's StoneHarry Potter has lived under the stairs at his aunt and uncle's house his whole life. But on his 11th birthday, he learns he's a powerful wizard—with a place waiting for him at the Hogwarts School of Witchcraft and Wizardry. As he learns to…Filme★8/10Inside OutWhen 11-year-old Riley moves to a new city, her Emotions team up to help her through the transition. Joy, Fear, Anger, Disgust and Sadness work together, but when Joy and Sadness get lost, they must journey through unfamiliar places to get …Filme★8/10Mission: Impossible - Rogue NationEthan and team take on their most impossible mission yet—eradicating 'The Syndicate', an International and highly-skilled rogue organization committed to destroying the IMF.Filme★7/10AtoresAlexander MendelukWadeKate NautaDianaBenjamin EasterdayLarsEric Scott WoodsDaleKelle CantwellMadisonRichard GleasonSheriffAmy NinhHiroJames OuimetDuffyNicole HelenCarolEmily AddisonJennaMike RuggieriRandyErin RossLacy