PT-PTServidor do playervideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesSlapface2022685 minTerrorThrillerEstreia21/04/2022PaísUnited States of AmericaProduçõesMirror Image FilmsChhibber Mann ProductionsArtman Cooper ProductionsA boy deals with the loss of his mother by creating a relationship with a dangerous monster.Similar vibes20 títulosJamon JamonJosé Luis has a cushy corporate job at the lingerie factory his mom owns. After he falls in love and proposes to Silvia, a beautiful laborer on the underwear assembly line, his mom enlists Raul, a potential underwear model and would-be bull…Filme★6/10Noroi: The CurseA documentary filmmaker explores seemingly unrelated paranormal incidents connected by the legend of an ancient demon.Filme★7/10The House That ScreamedSouthern France, 19th century. Teresa, a young girl, arrives at an isolated female boarding school that is tyrannically mastered by Mrs. Fourneau, the strict headmistress, whose protective shadow haunts Luis, her weak son.Filme★7/10The Day of the BeastThe story revolves around a Basque Roman Catholic priest dedicated to committing as many sins as possible, a death metal salesman from Carabanchel, and the Italian host of a TV show on the occult. These go on a literal "trip" through Christ…Filme★7/10ZA family find themselves terrorized by their eight-year-old son's imaginary friend.Filme★7/10BagheadFollowing the death of her estranged father, Iris learns she has inherited a run-down, centuries-old pub. She travels to Berlin to identify her father’s body and meet with The Solicitor to discuss the estate. Little does she know, when the …Filme★7/10The VaultMadrid, Spain, 2010. While the whole city follows the national team's successful participation in the World Cup, a group of daring thieves look for a way into one of the most secure and guarded places on the planet.Filme★7/10Gulliver's TravelsTravel writer Lemuel Gulliver takes an assignment in Bermuda, but ends up on the island of Liliput, where he towers over its tiny citizens.Filme★5/10MonsterAfter an outburst at school involving her son, a concerned single mother demands answers, triggering a sequence of deepening suspicion and turmoil.Filme★8/10CobwebEight year old Peter is plagued by a mysterious, constant tapping from inside his bedroom wall—one that his parents insist is all in his imagination. As Peter's fear intensifies, he believes that his parents could be hiding a terrible, dang…Filme★6/10The SadnessA young couple is pushed to the limits of sanity as they attempt to be reunited amid the chaos of a pandemic outbreak. The streets erupt into violence and depravity, as those infected are driven to enact the most cruel and ghastly things im…Filme★7/10Ghost ShipAfter discovering a passenger ship missing since 1962 floating adrift on the Bering Sea, salvagers claim the vessel as their own. Once they begin towing the ghost ship towards harbor, a series of bizarre occurrences happen and the group bec…Filme★6/10The First OmenWhen a young American woman is sent to Rome to begin a life of service to the church, she encounters a darkness that causes her to question her own faith and uncovers a terrifying conspiracy that hopes to bring about the birth of evil incar…Filme★7/10Dear JohnWhile Sergeant John Tyree is home on two weeks leave from Germany, he meets Savannah after he dives into the ocean to retrieve Savannah's purse that had fallen off a pier. John eventually falls in love with Savannah, who promises to write t…Filme★7/10OppenheimerThe story of J. Robert Oppenheimer's role in the development of the atomic bomb during World War II.Filme★8/10Ex MachinaCaleb, a coder at the world's largest internet company, wins a competition to spend a week at a private mountain retreat belonging to Nathan, the reclusive CEO of the company. But when Caleb arrives at the remote location he finds that he w…Filme★8/10Zack Snyder's Justice LeagueDetermined to ensure Superman's ultimate sacrifice was not in vain, Bruce Wayne aligns forces with Diana Prince with plans to recruit a team of metahumans to protect the world from an approaching threat of catastrophic proportions.Filme★8/10PKA stranger in the city asks questions no one has asked before. Known only by his initials, the man's innocent questions and childlike curiosity take him on a journey of love, laughter and letting go.Filme★8/10Dune: Part TwoFollow the mythic journey of Paul Atreides as he unites with Chani and the Fremen while on a path of revenge against the conspirators who destroyed his family. Facing a choice between the love of his life and the fate of the known universe,…Filme★8/10JokerDuring the 1980s, a failed stand-up comedian is driven insane and turns to a life of crime and chaos in Gotham City while becoming an infamous psychopathic crime figure.Filme★8/10AtoresAugust MaturoLucasMike C. ManningTomLibe BarerAnnaMirabelle LeeMoriahBianca D'AmbrosioDonnaChiara D'AmbrosioRoseLukas HasselThe MonsterDan HedayaSheriff John ThurstonAlixx SchottlandMrs. BlairJohn BackstromBartenderMack KuhrDeputy LeggettNick TheurerDeputy Shepard