ROServerul playeruluivideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesHead Count2019590 minHorrorThrillerMisterLansare14 iun. 2019ȚarăUnited States of AmericaProducțieGodmother IndustriesNewcomer Evan joins a group of teens on a getaway in Joshua Tree. While exchanging ghost stories around the campfire, Evan reads aloud a mysterious chant from an internet site. From that moment, someone--or something--is among them.ActoriIsaac JayEvanAshleigh MorghanZoeChelcie MayVanessaBevin BruCamilleCooper RowePeytonTory FreethToriBilly MeadeMaxMichael Alan HermanSamAmaka ObiechieHaleyHunter PetersonNicoSam MarraBryanSimilar vibes20 titluriGeneration WealthOver the past 25 years, Lauren Greenfield's documentary photography and film projects have explored youth culture, gender, body image, and affluence. Underscoring the ever-increasing gap between the haves and the have-nots, portraits reveal…Film★6/10A.M.I.A seventeen year old girl forms a co-dependent relationship with an artificial intelligence on her phone and goes on a murderous rampage.Film★4/10Crash SiteA vacationing couple's jeep crashes in an isolated location. They have to fight their way back to civilisation in spite of injuries and dangerous animals.Film★4/10Head CountAfter escaping prison Kat finds his own revolver pointed to his head by an unknown assailant. As the empty rounds click away, Kat tries to remember what happened to each bullet.Film★5/10BaitA freak tsunami traps shoppers at a coastal Australian supermarket inside the building ... along with a 12-foot great white shark.Film★6/10The Drawn Together Movie: The Movie!When the mystery-solving musician Foxxy Love notices she and her fellow housemates can curse without being bleeped—something they've never been able to do before—she realizes their show has been canceled. Determined to get back on the air, …Film★6/10HolidaysAn anthology feature film that puts a uniquely dark and original spin on some of the most iconic and beloved holidays of all time by challenging our folklore, traditions and assumptions.Film★5/10The Lodgers1920, rural Ireland. Anglo-Irish twins Rachel and Edward share a strange existence in their crumbling family estate. Each night, the property becomes the domain of a sinister presence (The Lodgers) which enforces three rules upon the twins:…Film★5/10Don't Let GoA detective suffering from a personal loss receives a call from his recently deceased niece. Being able to communicate across time, the two work together to try and stop the crime before it occurs.Film★7/10The MessengersWhen the Solomons trade in the craziness of big-city life for the quiet of a North Dakota farm, little do they expect the nightmare that follows. Soon after arriving, teenage Jess (Kristen Stewart) and her younger brother see terrifying app…Film★6/10The PerfectionWhen troubled musical prodigy Charlotte seeks out Elizabeth, the new star pupil of her former school, the encounter sends both musicians down a sinister path with shocking consequences.Film★6/10Scooby-Doo! Return to Zombie IslandScooby-Doo and his pals win an all-expense paid vacation and embark on a trip of a lifetime to a tropical paradise. Their destination however, turns out to be Zombie Island. As soon as they arrive, they realize the place looks strangely fam…Film★7/10The InvitationWill and his new girlfriend Kira are invited to a dinner with old friends at the house of Will’s ex Eden and her new partner David. Although the evening appears to be relaxed, Will soon gets a creeping suspicion that their charming host Dav…Film★6/10Paddington 2Paddington, now happily settled with the Browns, picks up a series of odd jobs to buy the perfect present for his Aunt Lucy, but it is stolen.Film★7/10T2 TrainspottingAfter 20 years abroad, Mark Renton returns to Scotland and reunites with his old friends Sick Boy, Spud and Begbie.Film★7/10The Ministry of Ungentlemanly WarfareDuring World War II, the British Army assigns a group of competent soldiers to carry out a mission against the Nazi forces behind enemy lines... A true story about a secret British WWII organization — the Special Operations Executive. Found…Film★7/10Freaky FridayMother and daughter bicker over everything -- what Anna wears, whom she likes and what she wants to do when she's older. In turn, Anna detests Tess's fiancé. When a magical fortune cookie switches their personalities, they each get a peek a…Film★7/10Ready or NotA young bride's wedding night turns into her worst nightmare when her ridiculously rich in-laws force her to play a gruesome game of hide-and-seek.Film★7/10Godzilla: King of the MonstersFollows the heroic efforts of the crypto-zoological agency Monarch as its members face off against a battery of god-sized monsters, including the mighty Godzilla, who collides with Mothra, Rodan, and his ultimate nemesis, the three-headed K…Film★7/10Bruce AlmightyBruce Nolan toils as a "human interest" television reporter in Buffalo, NY, but despite his high ratings and the love of his beautiful girlfriend, Bruce remains unfulfilled. At the end of the worst day in his life, he angrily ridicules God …Film★7/10