SIප්ලේයර් සේවාදායකයvideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesWhere Are You, Christmas?2023684 මිනිත්තුකල්පිතනಾಟಕටෙලිචිත්රනිකුත් වීම2023 ඔක් 21රටUnited States of Americaනිෂ්පාදනයHallmark MediaAfter Addy wishes for a year without Christmas, she wakes up in a black and white world and works with the town mechanic to restore Christmas.නළු නිළියෝLyndsy FonsecaAddyMichael RadyHunterJim O'HeirNickAndrew BridgesConnorMelanie SutrathadaSiennaMandi MasdenDanaJulie WarnerSharonMitch PoulosDr. RagoAlvin KeithMayor MattJoanna CarpenterSumaTom HairMr. BrownChris CarfizziJewelerSimilar vibesශීර්ෂ 20Everything You Always Wanted to Know About Sex *But Were Afraid to AskA collection of seven vignettes, which each address a question concerning human sexuality. From aphrodisiacs to sexual perversion to the mystery of the male orgasm, characters like a court jester, a doctor, a queen and a journalist adventur…චිත්රපටය★7/10Operation NutcrackerWhen an antique nutcracker set to be auctioned at the Warby family Christmas charity goes missing, a demanding event planner and the heir to the Warby dynasty try to track it down.චිත්රපටය★7/10T.I.M.Prosthetics scientist Abi and her adulterous husband Paul adjust to life outside the city as Abi begins working for high-tech company Integrate, developing a humanoid AI - T.I.M.චිත්රපටය★6/10Warm BodiesAfter a zombie becomes involved with the girlfriend of one of his victims, their romance sets in motion a sequence of events that might transform the entire lifeless world.චිත්රපටය★7/10Red OneAfter Santa Claus (codename: Red One) is kidnapped, the North Pole's Head of Security must team up with the world's most infamous tracker in a globe-trotting, action-packed mission to save Christmas.චිත්රපටය★7/10OppenheimerThe story of J. Robert Oppenheimer's role in the development of the atomic bomb during World War II.චිත්රපටය★8/10JokerDuring the 1980s, a failed stand-up comedian is driven insane and turns to a life of crime and chaos in Gotham City while becoming an infamous psychopathic crime figure.චිත්රපටය★8/10Zack Snyder's Justice LeagueDetermined to ensure Superman's ultimate sacrifice was not in vain, Bruce Wayne aligns forces with Diana Prince with plans to recruit a team of metahumans to protect the world from an approaching threat of catastrophic proportions.චිත්රපටය★8/10DeadpoolThe origin story of former Special Forces operative turned mercenary Wade Wilson, who, after being subjected to a rogue experiment that leaves him with accelerated healing powers, adopts the alter ego Deadpool. Armed with his new abilities …චිත්රපටය★8/101917At the height of the First World War, two young British soldiers must cross enemy territory and deliver a message that will stop a deadly attack on hundreds of soldiers.චිත්රපටය★8/10ParasiteAll unemployed, Ki-taek's family takes peculiar interest in the wealthy and glamorous Parks for their livelihood until they get entangled in an unexpected incident.චිත්රපටය★8/10Ex MachinaCaleb, a coder at the world's largest internet company, wins a competition to spend a week at a private mountain retreat belonging to Nathan, the reclusive CEO of the company. But when Caleb arrives at the remote location he finds that he w…චිත්රපටය★8/10Mission: Impossible - Dead Reckoning Part OneEthan Hunt and his IMF team embark on their most dangerous mission yet: To track down a terrifying new weapon that threatens all of humanity before it falls into the wrong hands. With control of the future and the world's fate at stake and …චිත්රපටය★8/10Inside OutWhen 11-year-old Riley moves to a new city, her Emotions team up to help her through the transition. Joy, Fear, Anger, Disgust and Sadness work together, but when Joy and Sadness get lost, they must journey through unfamiliar places to get …චිත්රපටය★8/10The Two PopesFrustrated with the direction of the church, Cardinal Bergoglio requests permission to retire in 2012 from Pope Benedict. Instead, facing scandal and self-doubt, the introspective Pope Benedict summons his harshest critic and future success…චිත්රපටය★7/10Dracula UntoldVlad Tepes is a great hero, but when he learns the Sultan is preparing for battle and needs to form an army of 1,000 boys, he vows to find a way to protect his family. Vlad turns to dark forces in order to get the power to destroy his enemi…චිත්රපටය★6/10The FavouriteEngland, early 18th century. The close relationship between Queen Anne and Sarah Churchill is threatened by the arrival of Sarah's cousin, Abigail Hill, resulting in a bitter rivalry between the two cousins to be the Queen's favourite.චිත්රපටය★7/10Everything Everywhere All at OnceAn aging Chinese immigrant is swept up in an insane adventure, where she alone can save what's important to her by connecting with the lives she could have led in other universes.චිත්රපටය★8/10AvatarIn the 22nd century, a paraplegic Marine is dispatched to the moon Pandora on a unique mission, but becomes torn between following orders and protecting an alien civilization.චිත්රපටය★8/10Birds of Prey (and the Fantabulous Emancipation of One Harley Quinn)Harley Quinn joins forces with a singer, an assassin and a police detective to help a young girl who had a hit placed on her after she stole a rare diamond from a crime lord.චිත්රපටය★7/10