SIප්ලේයර් සේවාදායකයvideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesThe Lost World19257104 මිනිත්තුසංචාරකල්පිතනಾಟಕභීතියසංවේගවිද්යාත්මකආදරනිකුත් වීම1925 පෙබ 02රටUnited States of Americaනිෂ්පාදනයFirst National PicturesThe first film adaptation of Sir Arthur Conan Doyle's classic novel about a land where prehistoric creatures still roam.නළු නිළියෝBessie LovePaula WhiteLewis StoneSir John RoxtonWallace BeeryProf. ChallengerLloyd HughesEdward E. MaloneAlma BennettGladys HungerfordArthur HoytProf. SummerleeMargaret McWadeMrs. ChallengerBull MontanaApe ManFrank Finch SmilesChallengers DienerJules CowlesZamboGeorge BunnyColin McArdleCharles WellesleyMaj. HibbardSimilar vibesශීර්ෂ 20Men & ChickenMen & Chicken is a black comedy about two outcast brothers who, by getting to know their unknown family, discover a horrible truth about themselves and their relatives.චිත්රපටය★6/10The Miracle1960s Turkey countryside. A newly assigned teacher finds out that the solitary village is missing a school. He gets fond of the village people and especially a disabled man. The teacher helps the village to build a new school and educate th…චිත්රපටය★7/10Passage of VenusPhoto sequence of the rare transit of Venus over the face of the Sun, one of the first chronophotographic sequences. In 1873, P.J.C. Janssen, or Pierre Jules César Janssen, invented the Photographic Revolver, which captured a series of ima…චිත්රපටය★6/10The Hound of the BaskervillesWhen a nobleman is threatened by a family curse on his newly inherited estate, detective Sherlock Holmes is hired to investigate.චිත්රපටය★7/10The FreshmanAn unathletic college freshman ridiculed by his peers for his mannerisms strives to become popular by making the football team.චිත්රපටය★7/10The Lost WorldA scientist discovers dinosaurs on a remote plateau in Mongolia.චිත්රපටය★5/10The Dinosaur and the Missing Link: A Prehistoric TragedyTwo cavemen, The Duke and Stonejaw Steve, call on Miss Araminta Rockface. The hated rivals fight, and Steve wins when he throws The Duke into a pot of boiling water. A title card introduces a third rival, "our unassuming hero, Theophilus Iv…චිත්රපටය★6/10The Death StarUnseen, unheard, mysterious explosions of unimaginable violence are ripping through the universe, with such power that they could literally shred our solar system to bits. Over the last few years astronomers have concluded that this force c…චිත්රපටය★10/10Battle CircusA young Army nurse, Lt Ruth McGara, newly assigned to the 8666th MASH during the Korean War, attracts the sexual attention of the unit's commander Dr. Jed Webbe. Major Webbe, who has a drinking problem, at first wants a "no strings" relatio…චිත්රපටය★6/10LimelightA fading music hall comedian tries to help a despondent ballet dancer learn to walk and to again feel confident about life.චිත්රපටය★8/10Chopping MallHigh-tech robots equipped with state-of-the-art security devices have been recruited as the new mechanical "night watchmen" for the Park Plaza Mall. When a jolting bolt of lightning short-circuits the main computer control, the robots turn …චිත්රපටය★6/10The Great Train RobberyAfter the train station clerk is assaulted and left bound and gagged, then the departing train and its passengers robbed, a posse goes in hot pursuit of the fleeing bandits.චිත්රපටය★7/10Tora! Tora! Tora!In the summer of 1941, the United States and Japan seem on the brink of war after constant embargos and failed diplomacy come to no end. "Tora! Tora! Tora!", named after the code words used by the lead Japanese pilot to indicate they had su…චිත්රපටය★7/1020,000 ලීග්ස් මුහුද යටරහස්මය මරණ තරංගයක් පරීක්ෂා කිරීමට යවන ලද නෞකාව, නවීන යාත්රා නාවිකයා නටීලස්, නායක කපිතාන් නෙමෝගේ නායකත්වයෙන් හමුවේ.චිත්රපටය★7/10Comment c'est loinAfter ten years of doing nothing, Orel and Gringe are in their mid 30s and they struggle to finish their first rap album. Their texts are mostly sex jokes and booze stories and reflect the everyday life they have in a small town from France…චිත්රපටය★7/10The Returnවසර විස්සකට පසු, ඔඩිසියස් ඉතාකා වෙරළට සේදී යයි, හැගර්ඩ් සහ හඳුනාගත නොහැක. රජු අවසානයේදී ආපසු නිවසට පැමිණ ඇත, නමුත් ට් රෝජන් යුද්ධයට එරෙහිව සටන් කිරීමට පිටත්ව ගිය දා සිට ඔහුගේ රාජධානියේ බොහෝ දේ වෙනස් වී ඇත.චිත්රපටය★6/10රශොමොන්පිරිස් හතරක් මිනිසාගේ කඩුව සහ ඔහුගේ බිරිඳේ අපරාධය පිළිබඳ වෙනස් කතා පවසයි.චිත්රපටය★8/10I'm Still HereA woman married to a former politician during the 1971 military dictatorship in Brazil is forced to reinvent herself and chart a new course for her family after a violent and arbitrary act.චිත්රපටය★8/10CrankChev Chelios, a hit man wanting to go straight, lets his latest target slip away. Then he awakes the next morning to a phone call that informs him he has been poisoned and has only an hour to live unless he keeps adrenaline coursing through…චිත්රපටය★7/10Dragon Ball Super: BrolyEarth is peaceful following the Tournament of Power. Realizing that the universes still hold many more strong people yet to see, Goku spends all his days training to reach even greater heights. Then one day, Goku and Vegeta are faced by a S…චිත්රපටය★8/10