SIප්ලේයර් සේවාදායකයvideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesThe Oath20166110 මිනිත්තුනಾಟಕසංවේගඅපරාධනිකුත් වීම2016 සැප් 06රටවල්Germany, Iceland, United Kingdomනිෂ්පාදනRVK StudiosFilm4 ProductionsWhen his daughter's criminal boyfriend becomes an increasing threat to the family, a father must take action to protect them.නළු නිළියෝBaltasar KormákurFinnurHera HilmarAnnaGísli Örn GarðarssonÓttarMargrét BjarnadóttirSolveigAuður AradóttirHrefnaIngvar E. SigurðssonHalldórÞorsteinn BachmannRagnarJoi JohannssonCopThelma GudmundsNurseSigrún Edda BjörnsdóttirRagnheiðurÞorsteinn GunnarssonGulliÞröstur Leó GunnarssonEldri MaðurSimilar vibesශීර්ෂ 20The Lodgers1920, rural Ireland. Anglo-Irish twins Rachel and Edward share a strange existence in their crumbling family estate. Each night, the property becomes the domain of a sinister presence (The Lodgers) which enforces three rules upon the twins:…චිත්රපටය★5/10The SacramentTwo journalists set out to document their friend's journey to reunite with his estranged sister. They track her to an undisclosed location where they are welcomed into the remote world of "Eden Parish," a self-sustained rural utopia compose…චිත්රපටය★6/10SleightA young street magician is left to take care of his little sister after his mother's passing and turns to drug dealing in the Los Angeles party scene to keep a roof over their heads. When he gets into trouble with his supplier, his sister i…චිත්රපටය★5/10RebeccaStory of a young woman who marries a fascinating widower only to find out that she must live in the shadow of his former wife, Rebecca, who died mysteriously several years earlier. The young wife must come to grips with the terrible secret …චිත්රපටය★8/10WelcomeBilal is 17 years old, a Kurdish boy from Iraq. He sets off on an adventure-filled journey across Europe. He wants to get to England to see his love who lives there. Bilal finally reaches Calais, but how do you cover 32 kilometers of the En…චිත්රපටය★7/10The WarningTen-year-old Nico receives a threatening letter and now his life is in danger. No one seems to believe him except one person that he doesn't know.චිත්රපටය★6/10Dark RiverAfter her father dies, a young woman returns to her Yorkshire village for the first time in 15 years to claim the family farm she believes is hers.චිත්රපටය★6/10Tad, the Lost Explorer, and the Secret of King MidasTad dreams of becoming an archaeologist traveling the world, uncovering hidden secrets and lost treasure, but his job working construction keeps him daydreaming instead of exploring. The chance of a lifetime comes when he is invited to atte…චිත්රපටය★7/10Blinded by the LightIn 1987, during the austere days of Thatcher’s Britain, a teenager learns to live life, understand his family, and find his own voice through the music of Bruce Springsteen.චිත්රපටය★7/10The Girl with All the GiftsIn the future, a strange fungus has changed nearly everyone into thoughtless, flesh-eating monsters. When a scientist and a teacher find a girl who seems to be immune to the fungus, they all begin a journey to save humanity.චිත්රපටය★7/10Beautiful CreaturesEthan Wate just wants to get to know Lena Duchannes better, but unbeknownst to him, Lena has strange powers. As Lena's 16th birthday approaches she might decide her fate, to be good or evil. A choice which will impact her relationship for…චිත්රපටය★6/10Wind RiverAn FBI agent teams with the town's veteran game tracker to investigate a murder that occurred on a Native American reservation.චිත්රපටය★7/10The NunA priest with a dark past and a novice nearing her final vows are sent by the Vatican to Romania to investigate a nun's death and face a demonic force.චිත්රපටය★6/10Hacksaw RidgeWWII American Army Medic Desmond T. Doss, who served during the Battle of Okinawa, refuses to kill people and becomes the first Conscientious Objector in American history to receive the Congressional Medal of Honor.චිත්රපටය★8/10Inside OutWhen 11-year-old Riley moves to a new city, her Emotions team up to help her through the transition. Joy, Fear, Anger, Disgust and Sadness work together, but when Joy and Sadness get lost, they must journey through unfamiliar places to get …චිත්රපටය★8/10OppenheimerThe story of J. Robert Oppenheimer's role in the development of the atomic bomb during World War II.චිත්රපටය★8/10SoulJoe Gardner is a middle school teacher with a love for jazz music. After a successful audition at the Half Note Club, he suddenly gets into an accident that separates his soul from his body and is transported to the You Seminar, a center in…චිත්රපටය★8/10Jojo RabbitJojo, a lonely German boy during World War II has his world shaken when he learns that his single mother is hiding a Jewish girl in their home. Influenced by a buffoonish imaginary version of Adolf Hitler, he begins to question his beliefs …චිත්රපටය★8/10Zack Snyder's Justice LeagueDetermined to ensure Superman's ultimate sacrifice was not in vain, Bruce Wayne aligns forces with Diana Prince with plans to recruit a team of metahumans to protect the world from an approaching threat of catastrophic proportions.චිත්රපටය★8/101917At the height of the First World War, two young British soldiers must cross enemy territory and deliver a message that will stop a deadly attack on hundreds of soldiers.චිත්රපටය★8/10