SKServer prehrávačavideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesInto the Labyrinth20196130 minThrillerMysterióznyVydané30. 10. 2019KrajinaItalyProdukcieGavilaMedusa FilmColorado Film ProductionBanca Sella PatrimoniWhen a kidnapping victim turns up alive after fifteen years, a profiler and a private investigator try to piece together the mystery.HerciToni ServilloBruno GenkoDustin HoffmanDottor GreenValentina BellèSamantha AndrettiVinicio MarchioniSimon BerishRiccardo CicognaPaul MacinskyCaterina ShulhaLindaOrlando CinqueBauerFilippo DiniDelacroixSergio GrossiniPeter Lai / RizzoCarla CassolaSig.ra WilsonLuis GneccoMordecai LumannStefano Rossi GiordaniRagazzo con cicatriceSimilar vibes20 titulovThe Girl in the FogA gripping and chilling thriller that brings us to a hazy mountain village where an enigmatic detective is investigating the sudden disappearance of fifteen-year-old girl.Film★7/10YouI had been looking for someone's unnerving encounter, that conversation that one just couldn't get out of their head, the kind of event that leaves one still debating out loud while walking in the streets or doing one's tidies in the bathro…Film★6/10The Barcelona VampiressBarcelona, Spain, 1912. The disappearance of a girl from a wealthy family triggers a series of events that will shake the weak foundations of a hypocritical society.Film★6/10The ChairmanAn American scientist is sent to Red China to steal the formula for a newly developed agricultural enzyme. What he is not told by his bosses is that a micro-sized bomb has been planted in his brain so that should the mission ever look likel…Film★5/10Taeter CityIn Taeter City, there is no crime. Using Zeed radio waves, the city’s dictatorship cause criminals to commit suicide. Their corpses are processed and sold as fast-food by conglomerates who nourish the ravenous populace. It was a perfect sys…Film★4/10GhiaccioGiorgio is a young talented boxer who lives with his mother and dreams to became a champion.Film★7/10The Guest RoomThe morning Stella decides to take her own life, a stranger knocks at her door claiming the guest room he booked for the night. Surprised but charmed by this man who seems to know her very well, Stella decides to let him in. But when Sandro…Film★6/10Robbing MussoliniNear the end of WWII, a young bootlegger and his nightclub-singing girlfriend assemble a ragtag team for an dangerous heist: to steal Mussolini's treasure right from his headquarters.Film★6/10I Am the AbyssThe Man Who Cleans knows you can find a lot of secrets in trash. People tend to lie but their trash never does. The Man Who Cleans thought he was invisible, until he met the Girl with the Purple Hair Lock. Girl with the Purple Hair Lock bre…Film★6/10The Life Before Her EyesAs the 15th anniversary of a fatal high school shooting approaches, former pupil Diana McFee is haunted by memories of the tragedy. After losing her best friend Maureen in the attack, Diana has been profoundly affected by the incident - her…Film★6/10Magical NightsRome, 1990. The night Italy's national football team is eliminated from the World Cup by Argentina on penalty kicks, a well-known film producer is found dead in the Tiber river. The main suspects for the murder are three young aspiring scre…Film★6/10The Last FaceMiguel, a heroic Spanish doctor, puts himself in harm's way to deliver medical treatment to the victims of military uprisings in Africa.Film★6/10Young OnesIn a future where water is scarce, a farmer defends his land and hopes to rejuvenate his parched soil. However, his daughter's boyfriend schemes to steal the land for himself.Film★6/10Reservation RoadTwo fathers' lives intersect when one of them is involved in a terrible and sudden hit-and-run car accident that leaves the other's son dead. In response, the two men react in unexpected ways as a reckoning looms in the near future.Film★7/10Rescue Under FireThe crew of a medical helicopter suffers an accident when helping a joint force of USA and United Nations troops under Spanish command division in Afghanistan. The Spanish army has only one night to organize the rescue of the crew and injur…Film★7/10Bloody HellA man with a mysterious past flees the country to escape his own personal hell... only to arrive somewhere much worse. In an effort to survive this new horror, he turns to his personified conscience.Film★6/10Happier Than Ever: A Love Letter to Los AngelesFresh off the heels of her brand-new album, "Happier Than Ever," this cinematic concert experience features an intimate performance of every song in the album's sequential order – for the first and only time – from the stage of the legendar…Film★8/10My Name Is Francesco TottiFrancesco Totti retraces his entire life while watching it on the silver screen together with the audience. Images and emotions flow among key moments of his career, scenes from his personal life and memories he has never shared before.Film★7/105 Is the Perfect NumberPeppino, a retired hitman for the Camorra, has now fully passed on his job and know-how to his single son, Nino. But when Nino is brutally assassinated, the old man is back in business to take revenge. Aside his everlasting love Rita and hi…Film★6/10War of the ArrowsAfter the death of their father, two siblings are raised by their father's best friend. However, when one gets kidnapped just before her wedding, the other rises against the Manchus.Film★7/10