SKServer prehrávačavideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesThe Swarm20216101 minDrámaHorrorVydané09. 4. 2021KrajinaFranceProdukcieCapricci FilmsThe Jokers FilmsARTE France CinémaAuvergne-Rhône-Alpes CinémaA single mother breeds locusts as high-protein foods but has trouble getting them to reproduce until she finds they have a taste for blood.Similar vibes20 titulovThe Space in Between: Marina Abramović and BrazilMarina Abramović travels through Brazil, in search of personal healing and artistic inspiration, experiencing sacred rituals and revealing her creative process. The route is comprised of poignant encounters with healers and sages from the B…Film★8/10The Merry WidowA prince from a small kingdom courts a wealthy widow to keep her money in the country.Film★7/10The Rio Verde IncidentA story about love and breaking social barriers, set against the Rio Verde plane crash that killed the players of the Santiago baseball team in 1948.Film★6/10The Cannibal ClubOtavio and Gilda are a very wealthy couple of the Brazilian elite who have the habit of eating their employees. Otavio owns a private security company and is a notable member of The Cannibal Club. When Gilda accidentally discovers a secret …Film★5/10Safer at HomeTwo years into the pandemic, a group of friends throw an online party with a night of games, drinking and drugs. After taking an ecstasy pill, things go terribly wrong and the safety of their home becomes more terrifying than the raging cha…Film★5/10Holiday on MarsWe are in 2030, and on vacation we go to Mars! Having made his wife and son Giulio lose his tracks for years, Fabio (Christian De Sica) is about to marry the wealthy Bea on Mars. But what could happen if during an excursion into space, som…Film★3/10The Chef's WifeThe wife of a successful chef feels unfulfilled in her rôle as dining-room hostess and consults career counselor, who is herself dissatisfied by her useful but mundane place in the scheme of things. Without meaning to, the two women find th…Film★5/10Plan AGermany 1945, Max, a Jewish Holocaust survivor, meets a radical group of Jewish resistance fighters, who, like him, lost all hope for their future after they were robbed of their existence and their entire families were killed by the Nazis.…Film★6/10InsensateA woman tries to help her twin sister, with whom she has a strong connection, recover from a trauma. But weird things surround their lives.Film★7/10TeddyIn a rural French town, twenty-something Teddy is scratched by an unknown beast and slowly undergoes frightening changes.Film★6/10Die in a GunfightMary and Ben are the star-crossed black sheep of two powerful families engaged in a centuries-long feud. When the pair reignite a romance after many years apart, their forbidden love draws a motley assortment of schemers and killers into th…Film★5/10Escape from MogadishuDiplomats from the North and South Korean embassies in Somalia attempt a daring joint escape from Mogadishu when the outbreak of civil war leaves them stranded.Film★7/10TrainAfter a night of wild partying and missing their train, the group of students is invited to board another which happens to be heading their way. Once on board, members of the team begin to go missing, and their would-be saviors claim to hav…Film★5/10The Best Christmas Pageant EverThe Herdman kids are undeniably the worst kids in the history of the world. They lie, steal, cheat, bully and overall terrorize their small community. But this Christmas, they're taking over their local church Pageant – and they just might …Film★7/10BartkowiakAfter his brother dies in a car crash, a disgraced MMA fighter takes over the family nightclub — and soon learns his sibling's death wasn’t an accident.Film★6/10Anaïs in LoveA young woman struggling to stay on top of everything in her life meets a married publisher and begins an affair with him.Film★6/10FranceA celebrity journalist, juggling her busy career and personal life, has her life over-turned by a freak car accident.Film★5/10AftermathDesperate to save their marriage, a young couple takes a deal to move into their dream home, but disturbing events reveal the house's troubled history.Film★6/10The Lighthouse of the OrcasA mother travels to Patagonia with her autistic son with the hope that a ranger and a pod of wild orcas can help him find an emotional connection.Film★7/10Cheap ThrillsRecently fired and facing eviction, a new dad has his life turned upside down when he meets a wealthy couple who offer a path to financial security... but at a price.Film★6/10HerciSuliane BrahimVirginieSofian KhammesKarimMarie NarbonneLauraRaphael RomandGastonNathalie BoyerKévin's motherVictor BonnelKévinChristian BouilletteDuvivierRaphaël LiotFootball coach