SKIt's Such a Beautiful DayServer prehrávačavideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesIt's Such a Beautiful Day2011823 minAnimovanýDrámaKomédiaVydané17. 11. 2011KrajinaUnited States of AmericaProdukciaBitter FilmsDark and troubling events force Bill to reckon with the meaning of his life.Similar vibes20 titulovWorld of TomorrowA little girl is taken on a mind-bending tour of her distant future.Film★8/10The Pervert's Guide to IdeologyA journey into the labyrinthine heart of ideology, which shapes and justifies both collective and personal beliefs and practices: with an infectious zeal and voracious appetite for popular culture, Slovenian philosopher and psychoanalyst Sl…Film★7/10I Am So Proud of YouDark shadows are cast over Bill's recovery.Film★8/10Ruin MeSix strangers sign up for a slasher movie re-enactment, in which they are dropped into the woods and pursued by knife wielding assassins. But when the body count becomes real, Alexandra must unravel the mystery of who is responsible if she …Film★5/10Denomination: SorrowA short poem from the perspective of a non-believer, that questions the realism of religious creation, using basic emotions as a motif.Film★10/10The Normal HeartThe story of the onset of the HIV-AIDS crisis in New York City in the early 1980s, taking an unflinching look at the nation's sexual politics as gay activists and their allies in the medical community fight to expose the truth about the bur…Film★8/10BlackfishNotorious killer whale Tilikum is responsible for the deaths of three individuals, including a top killer whale trainer. Blackfish shows the sometimes devastating consequences of keeping such intelligent and sentient creatures in captivity.Film★8/10Dead ManOn the run after committing murder, an accountant encounters a strange Native American man who prepares him for his journey into the spiritual world.Film★7/10Three Colors: BlueThe wife of a famous composer survives a car accident that kills her husband and daughter. Now alone, she shakes off her old identity and explores her newfound freedom but finds that she is unbreakably bound to other humans, including her h…Film★8/10A Monster Calls12-year-old Conor encounters an ancient tree monster who proceeds to help him cope with his mother's terminal illness and being bullied in school.Film★7/10Home Alone 2: Lost in New YorkInstead of flying to Florida with his folks, Kevin ends up alone in New York, where he gets a hotel room with his dad's credit card—despite problems from a clerk and meddling bellboy. But when Kevin runs into his old nemeses, the Wet Bandit…Film★7/10The Dark Knight RisesFollowing the death of District Attorney Harvey Dent, Batman assumes responsibility for Dent's crimes to protect the late attorney's reputation and is subsequently hunted by the Gotham City Police Department. Eight years later, Batman encou…Film★8/10The Lord of the Rings: The Return of the KingAs armies mass for a final battle that will decide the fate of the world--and powerful, ancient forces of Light and Dark compete to determine the outcome--one member of the Fellowship of the Ring is revealed as the noble heir to the throne …Film★8/10Titanic101-year-old Rose DeWitt Bukater tells the story of her life aboard the Titanic, 84 years later. A young Rose boards the ship with her mother and fiancé. Meanwhile, Jack Dawson and Fabrizio De Rossi win third-class tickets aboard the ship. …Film★8/10JokerDuring the 1980s, a failed stand-up comedian is driven insane and turns to a life of crime and chaos in Gotham City while becoming an infamous psychopathic crime figure.Film★8/10Batman BeginsDriven by tragedy, billionaire Bruce Wayne dedicates his life to uncovering and defeating the corruption that plagues his home, Gotham City. Unable to work within the system, he instead creates a new identity, a symbol of fear for the crim…Film★8/10Shutter IslandWorld War II soldier-turned-U.S. Marshal Teddy Daniels investigates the disappearance of a patient from a hospital for the criminally insane, but his efforts are compromised by troubling visions and a mysterious doctor.Film★8/10Once Upon a Time... in HollywoodLos Angeles, 1969. TV star Rick Dalton, a struggling actor specializing in westerns, and stuntman Cliff Booth, his best friend, try to survive in a constantly changing movie industry. Dalton is the neighbor of the young and promising actres…Film★7/10The Breakfast ClubFive high school students from different walks of life endure a Saturday detention under a power-hungry principal. The disparate group includes rebel John, princess Claire, outcast Allison, brainy Brian and Andrew, the jock. Each has a chan…Film★8/10Back to the FutureEighties teenager Marty McFly is accidentally sent back in time to 1955, inadvertently disrupting his parents' first meeting and attracting his mother's romantic interest. Marty must repair the damage to history by rekindling his parents' r…Film★8/10HerciDon HertzfeldtNarrator (voice)Sara CushmanDoctor (voice)