SLStrežnik predvajalnikavideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesRurouni Kenshin Part I: Origins20128134 minAvanturaFantastikaAkcijaZgodovinskiVojno-političniIzdano25. avg. 2012DržavaJapanProdukcijeStudio SwanROCKWORKSC&I entertainmentIMJ EntertainmentAmuse Soft EntertainmentWarner Bros. Japan+2In 1868, after the Bakumatsu war ends, the ex-assassin Kenshin Himura traverses Japan with an inverted sword, to defend the needy without killing.IgralciTakeru SatohKenshin HimuraEmi TakeiKaoru KamiyaKoji KikkawaUdo JineYu AoiMegumi TakaniMunetaka AokiSanosuke SagaraGo AyanoGeinGenki SudoBanjin InuiTaketo TanakaYahiko MyojinEiji OkudaAritomo YamagataYosuke EguchiHajime SaitoTeruyuki KagawaKanryu TakedaKaoru HirataTae SekiharaSimilar vibes20 naslovovRurouni Kenshin Part II: Kyoto InfernoKenshin has settled into his new life with Kaoru and his other friends when he is approached with a request from the Meiji government. Makoto Shishio, a former assassin like Kenshin, was betrayed, set on fire and left for dead. He survived,…Film★8/10Rurouni Kenshin Part III: The Legend EndsShishio sets sail in his ironclad ship to bring down the government. In order to stop him, Kenshin trains with his old master to learn his final technique.Film★8/10Rurouni Kenshin: Requiem for the Ishin PatriotsThe war against the Tokugawa Shogunate ended years ago. But there are some who are not happy with the outcome. Shigure Takimi watched his friends and family get slashed down in the name of freedom and prosperity. Now he and a band of despar…Film★7/10HK: Hentai Kamen 2 - Abnormal CrisisNews about the disappearance of panties is still being covered every day. Kyosuke still wears Aiko Completo's panties to battle evil. Meanwhile, Aiko has mixed emotions and decides to get her panties back. Kyosuke suffers from the loss of A…Film★6/10Yakuza ApocalypseWhen young protege Akira Kageyama is bitten by his dying vampire boss, Genyo Kamiura, he must get used to his new powers before seeking revenge.Film★6/10Air Bud: Spikes BackAir Bud finds that he has the uncanny ability to play volleyball.Film★5/10BECKYukio is your average high school student who spends his days going to class and avoiding bullies. That is until he meets Ryusuke, a guitar prodigy. Together with Taira, Chiba, and Saku they form the rock band BECK. As their popularity incr…Film★7/10Untold: Shooting GuardsWhat really went down between Gilbert Arenas and Javaris Crittenton? This exposé unpacks how a gambling dispute led to guns drawn in an NBA locker room.Film★6/10The Canterbury TalesGlimpses of Chaucer penning his famous work are sprinkled through this re-enactment of several of his stories.Film★6/10Snake & Crane Arts of ShaolinJackie Chan stars as the young warrior Hsu Yiu Fong. Hsu has been entrusted with the book of the "Art of the Snake and Crane," after the mysterious disappearance of the eight Shaolin Masters who had written it. He must fight off numerous cl…Film★7/10Boarding GateA beautiful woman, Sandra, seduces a wealthy businessman, Miles Rennburg. Little does he realise that she has been sent to kill him at the behest of her boyfriend/crime partner, Lester. Controlling all this is Sue, Lester's wife.Film★5/10Satan's TriangleThe female survivor of a shipwreck and two Coast Guard helicopter pilots sent to rescue her find themselves trapped in a mysterious part of the ocean known as Satan's Triangle.Film★5/10Arn: The Kingdom at Road's EndArn has served his term in the Holy land and returns home to be reunited with his beloved Cecilia. When he returns home, he discovers that political forces tries to separate him and Cecilia - but thanks to queen Blanka they can finally get …Film★6/10All the SilenceMiriam teaches sign language in the mornings and is part of a professional theater production in the afternoons, maintaining a stable and passionate relationship with her girlfriend Lola. Although her life is very much connected to the rout…Film★7/10Nazis at the Center of the EarthA group of researchers in Antarctica are abducted by a platoon of masked soldiers and dragged into a hidden continent in the center of the Earth. There, they discover that surviving Nazi soldiers are plotting an invasion of Earth to revive …Film★3/10Paco and the Magical BookOnuki asks people in a hospital to perform a play for Paco, who suffers from memory disorder. His only hope is to help Paco survive from her illness.Film★7/10Fairy Tail: Phoenix PriestessThe film revolves around a mysterious girl named Éclair who appears before Fairy Tail, the world's most notorious wizard's guild. She lost all of her memories, except for the imperative that she must deliver two Phoenix Stones somewhere. Th…Film★7/10MW: The Devil's GameThe main character is a man named Takashi Morioka, who has lost his job and his home due to a recession. He ends up falling into a trap set by the diabolical Yuki Michio, who happened to survive by chance an incident on an island 16 years a…Film★5/10A Tale of Samurai CookingIn this love story set in the Edo period, 27-year-old Oharu is a genius in the kitchen. Oharu attracts the attention of the master chef of the Kaga Domain, who arranges for her to marry his son and heir, 24-year-old Yasunobu. But, Yasunobu …Film★7/10My Pretend GirlfriendNoboru is a high school student who isn't popular at all. He looks up to senior student Miyazaki who is one of the most popular guys at school. Miyazaki has two girlfriends: Momose and Tetsuko. Momose and Tetsuko have totally different pers…Film★6/10