SLStrežnik predvajalnikavideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesEvery Breath You Take20216105 minТrilerMisterijaIzdano02. apr. 2021DržaveGermany, United States of AmericaProdukcijeSouthpaw EntertainmentConstruction FilmVertical13 FilmsLighthouse PicturesA psychiatrist, whose client commits suicide, finds his family life disrupted after introducing her surviving brother to his wife and daughter.IgralciCasey AffleckPhillipMichelle MonaghanGraceSam ClaflinJamesEmily Alyn LindDaphneIndia EisleyLucyHiro KanagawaDr. TothVeronica FerresDr. Vanessa FanningLilly KrugLilly FanningVincent GaleStuart FanningBrenden SunderlandEvanSimilar vibes20 naslovovAzzurri: Road to WembleyA docu-film that traces the victorious ride of Mancini's Azzurri, from the debut match to the final against England. A troupe lived with the Azzurri for a month, to bring the spectators into the lives of the players and all the members of t…Film★8/10HurtThere are terrible things happening in the desert...unexplainable, frightening things. Tragic, inexplicable incidents… ever since she arrived.Film★5/10RiddleHolly & Nathan Teller live in a small town in Pennsylvania. Holly is on the cheerleading team and has a close relationship with her younger brother Nathan, who is subjected to bullying at school. Nathan is taken for a car ride one day …Film★5/10The Last RiderThe incredible story of the greatest cycling race in history, the 1989 Tour de France, and how American Greg LeMond faced down betrayal, childhood sexual abuse and death completing one of the most inspiring comebacks in history.Film★8/10White BlessingWhite Blessing is motivational sports drama and based on a true story.Film★6/10Naked SingularityWhen a successful New York public defender loses his first case, he is pulled into a drug heist by a former client in an effort to beat the broken system at its own game.Film★5/10I Fratelli De FilippoThe story of the De Filippo brothers, children of Eduardo Scarpetta.Film★7/10Single Mother by ChoiceTracking a real-life pregnancy, this fictional film tells the story of a Latinx workaholic who’s determined to have a baby on her own terms and gets more than she bargained for when she gets pregnant in the year 2020.Film★7/10Von Ryan's ExpressVon Ryan's Express stars Frank Sinatra as a POW colonel who leads a daring escape from WWII Italy by taking over a freight train, but he has to win over the British soldiers he finds himself commanding.Film★7/10Dream HorseThe inspiring true story of Dream Alliance, an unlikely race horse bred by small town bartender, Jan Vokes. With very little money and no experience, Jan convinces her neighbors to chip in their meager earnings to help raise Dream and compe…Film★7/10Brownian MovementA psychiatrist's adulterous past continues to haunt her and her husband after they move to India.Film★6/10The NeighborMoški srednjih let v stagnirajočem zakonu se mu življenje obrne na glavo, ko se v sosednjo hišo preselita privlačna mlada ženska in njen na videz nasilni mož.Film★5/10Til Death Do Us PartAfter bailing on her wedding, a former bride-to-be must fight off her ex-groom and seven angry killer groomsmen in order to survive the night.Film★6/10Deadly IllusionsA bestselling female novelist, suffering from writer's block, hires an innocent young woman to watch over her twin children. As the novelist dangerously indulges in her new best seller, the line between the life she's writing and the one sh…Film★5/10Franco Escamilla: EavesdroppingFranco Escamilla takes the stage in California for a comedy special filled with humorous observations on gossiping, the pandemic and airport experiences.Film★9/10ProximaPriznana znanstvenica in astronavtka Sarah Loreau (Eva Green) je dosegla vrhunec svoje kariere, ko so jo izbrali za eno izmed udeleženk enoletne odprave na mednarodno vesoljsko postajo. Ko začne z napornim telesnim in umskim urjenjem, se so…Film★6/10PreyA hiking trip into the wild turns into a desperate bid for survival for five friends on the run from a mysterious shooter.Film★5/10Blue BayouKorejsko-ameriški moški, vzgojen v zalivu Louisiana trdo dela, da bi ustvaril življenje za svojo družino, se mora soočiti z duhovi svoje preteklosti, ko odkrije, da bi ga lahko izgnali iz edine države, ki jo je kdaj imenoval dom.Film★7/10The SwarmA single mother breeds locusts as high-protein foods but has trouble getting them to reproduce until she finds they have a taste for blood.Film★6/10Prva kravaPreprosta lesena postojanka z enim samim majhnim salonom in vedno blatnimi ulicami The Royal West Pacific Trading Post je kraj, kjer se zbirajo lovci, trgovci, pustolovci in drugi bolj kot ne sumljivi avanturisti. Za prišleke prostrana oreg…Film★7/10