SRСервер плејераvideasyvidsrcvidfastvidlinkvidnestmoviesapi111movies#Selfie 6920167116 минАкциониКомедијаЉубавниОбјављено16. сеп 2016.ДржаваRomaniaПродукцијаZazu FilmYour best friends are also the friends who'll make you do the stupidest things. After parting hardcore, Roxi, Yasmine and Ana meet in a bet that will change their lives: Who gets married first in three days?Similar vibes20 насловаConeheadsA pair of aliens arrive on Earth to prepare for invasion, but crash instead. With enormous cone-shaped heads, robotlike walks and an appetite for toilet paper, aliens Beldar and Prymatt don't exactly blend in with the population of Paramus,…Филм★5/10Squared LoveA celebrity journalist and renowned womanizer starts to rethink his life choices after he falls for a mysterious model who leads a double life.Филм★6/10The WhistlersA Romanian police officer, determined to free from prison a crooked businessman who knows where a mobster's money is hidden, must learn the difficult ancestral whistling language (Silbo Gomero) used on the island of Gomera.Филм★6/10Drake & Josh Go HollywoodWhen Drake and Josh accidentally send their little sister Megan on a plane to L.A., they soon find themselves in the middle of a dangerous situation.Филм★7/10Bad 25Spike Lee pays tribute to Michael Jackson's Bad on the twenty-fifth anniversary of the epochal album, offering behind-the-scenes footage of Jackson recording the album and interviews with confidants, musicians, choreographers, and such musi…Филм★7/10That's AmorAfter her job and relationship implode on the same day, Sofia starts from scratch — and meets a dashing Spanish chef who might be her missing ingredient.Филм★5/10The Night Eats the WorldAfter waking up to find himself all alone in an apartment where a massive party was being held the night before, Sam is immediately forced to face a terrifying reality: the living dead have invaded the streets of Paris.Филм★6/10Warm BodiesAfter a zombie becomes involved with the girlfriend of one of his victims, their romance sets in motion a sequence of events that might transform the entire lifeless world.Филм★6/10Stand by MeAfter learning that a boy their age has been accidentally killed near their rural homes, four boys decide to go see the body. On the way, Gordie, Vern, Chris and Teddy encounter a mean junk man and a marsh full of leeches, as they also lea…Филм★8/10Pretty WomanWhile on a business trip in Los Angeles, Edward Lewis, a millionaire entrepreneur who makes a living buying and breaking up companies, picks up a prostitute, Vivian, while asking for directions; after, Edward hires Vivian to stay with him f…Филм★7/10Knives OutWhen renowned crime novelist Harlan Thrombey is found dead at his estate just after his 85th birthday, the inquisitive and debonair Detective Benoit Blanc is mysteriously enlisted to investigate. From Harlan's dysfunctional family to his de…Филм★8/10AquamanHalf-human, half-Atlantean Arthur Curry is taken on the journey of his lifetime to discover if he is worth of being a king.Филм★7/10OppenheimerThe story of J. Robert Oppenheimer's role in the development of the atomic bomb during World War II.Филм★8/10Titanic101-year-old Rose DeWitt Bukater tells the story of her life aboard the Titanic, 84 years later. A young Rose boards the ship with her mother and fiancé. Meanwhile, Jack Dawson and Fabrizio De Rossi win third-class tickets aboard the ship. …Филм★8/10JokerDuring the 1980s, a failed stand-up comedian is driven insane and turns to a life of crime and chaos in Gotham City while becoming an infamous psychopathic crime figure.Филм★8/10PKA stranger in the city asks questions no one has asked before. Known only by his initials, the man's innocent questions and childlike curiosity take him on a journey of love, laughter and letting go.Филм★8/10Ex MachinaCaleb, a coder at the world's largest internet company, wins a competition to spend a week at a private mountain retreat belonging to Nathan, the reclusive CEO of the company. But when Caleb arrives at the remote location he finds that he w…Филм★8/10Inside OutWhen 11-year-old Riley moves to a new city, her Emotions team up to help her through the transition. Joy, Fear, Anger, Disgust and Sadness work together, but when Joy and Sadness get lost, they must journey through unfamiliar places to get …Филм★8/10Once Upon a Time... in HollywoodLos Angeles, 1969. TV star Rick Dalton, a struggling actor specializing in westerns, and stuntman Cliff Booth, his best friend, try to survive in a constantly changing movie industry. Dalton is the neighbor of the young and promising actres…Филм★7/10Zack Snyder's Justice LeagueDetermined to ensure Superman's ultimate sacrifice was not in vain, Bruce Wayne aligns forces with Diana Prince with plans to recruit a team of metahumans to protect the world from an approaching threat of catastrophic proportions.Филм★8/10ГлумциCrina SemciucYasmineSilvia BusuiocIuliaAlexandru BogdanElvisOlimpia MelinteRoxiFlavia HojdaAnaMaria DinulescuSoniaRaluca AproduLauraLidia BublePiti 2Alex BuescuAlex CălinDorina ChiriacDiasporaAlina Chivulescu