SRСервер плејера111moviesvideasyvidsrcvidfastvidlinkvidnestmoviesapiЕпизода123456789101112Сезона12Toilet-Bound Hanako-kun20209ЦртаниМистеријаНаучна фантастикаОбјављено10. јан 2020.ДржаваЈапанПродукцијеLercheSquare EnixTBSPony CanyonContents SeedStudio Hibari+2To be united with her crush, a hopeless romantic summons the ghost in the girls' bathroom at her school. But she's shocked when the ghost is a boy!Similar vibes20 насловаBlend · SHigh school girl Maika Sakuranomiya has trouble finding a part-time job because of how scary she looks when smiling. However, she is scouted one day by Dino, the manager of the café Stile where its waitresses play unique traits such as tsun…Серија★8/10givenRitsuka’s lost his spark for music—until he hears Mafuyu sing. One voice pulls him back in, and suddenly, everything starts to change between them.Серија★9/10Tsuredure ChildrenA series depicting various scenarios of young love. These stories range from a boy, crippled by his absolute lack of confidence in himself, cannot even accept the fact that the girl of his dreams actually asked him out on a date, to the nea…Серија★8/10Yamada's First Time: B Gata H KeiOMG! There’s this girl at school, Yamada, who wants to make like a hundred sex friends. She totally thinks she can devirginize one hundred different boys! Can you believe that? That’s like every boy in the school. Who does she think she is?…Серија★8/10Deadman WonderlandGanta is the only survivor after a mysterious man in red slaughters a classroom full of teenagers. He's framed for the carnage, sentenced to die, and locked away in the most twisted prison ever built: Deadman Wonderland. And then it gets wo…Серија★8/10How to Keep a MummyWhen high school student Sora Kashiwagi finds himself staring down a mysterious oversized package sent to him by his self-proclaimed "adventurer" father, the last thing he expects is for it to be opened from the inside... by a little mummy …Серија★8/10Kamisama KissNanami was just a normal high school girl down on her luck until a stranger’s lips marked her as the new Land God and turned her world upside down. Now, she’s figuring out the duties of a deity with the help of Tomoe, a reformed fox demon w…Серија★9/10The Helpful Fox Senko-sanLike many hardworking members of the workforce, Kuroto Nakano is perpetually stressed out by his job. Still, since he lives alone, he must carry on to sustain himself. Little do humans like Kuroto know, this stress takes the form of darknes…Серија★8/10Seton Academy: Join the Pack!Seton Academy, a school full of animals where, thanks to population decline, there are fewer humans than any other creature. Mazama Jin, an animal hater and the only human male in his class, falls in love with Hino Hitomi, the only female h…Серија★8/10Mob Psycho 100Shigeo Kageyama, a.k.a. "Mob," is a boy who has trouble expressing himself, but who happens to be a powerful esper. Mob is determined to live a normal life and keeps his ESP suppressed, but when his emotions surge to a level of 100%, someth…Серија★8/10Great PretenderSupposedly Japan's greatest swindler, Makoto Edamura gets more than he bargained for when he tries to con Laurent Thierry, a real world-class crook.Серија★7/10SaikanoSaikano: The Last Love Song on This Little Planet. is a manga, anime, and OVA series by Shin Takahashi, creator of Iihito and Kimi no Kakera. Saikano was originally serialized in Shogakukan's Big Comic Spirits magazine. A live-action movie…Серија★8/10Daa! Daa! Daa! UFO BabyDaa! Daa! Daa! UFO Baby is a Japanese children's animated television series produced by J.C.Staff, Directed by Hiroaki Sakurai, and was aired on NHK-BS2 from March 28, 2000 to February 26, 2002.Серија★8/10XIt's the year of destiny and 15 year old Kamui Shirō, a powerful psychic, has returned to Toyko after a 6 year absence. He returns to protect his childhood friends, Fūma, and Fūma's younger sister, Kotori. But destiny and fate are haunting…Серија★7/10Dave the BarbarianThis animated comedy series is set in the Middle Ages and follows the title character, Dave, in his comedic adventures with his family (his sisters, Candy and Fang) as they protect themselves and their family from a world of oddball foes. D…Серија★8/10Girlfriend, GirlfriendNaoya Mukai has loved Saki Saki since grade school, and when she finally accepts his feelings, he's at his happiest. But one day, a cute girl named Nagisa Minase confesses to him! Not wishing to choose only one over another, Naoya chooses t…Серија★7/10As a Reincarnated Aristocrat, I'll Use My Appraisal Skill to Rise in the WorldArs Louvent is reincarnated in another world as the young son of a minor noble who owns a small domain. Ars is not particularly strong or intelligent, but he was born with the Appraisal Skill that's able to see others' abilities and statuse…Серија★7/10Richie RichRichie Rich is an animated television series produced by Hanna-Barbera Productions that aired on ABC from 1980 to 1984 and again in 1988 as part of the weekend/weekday programming block The Funtastic World of Hanna-Barbera, Based upon Harve…Серија★7/10BURN THE WITCHHistorically 72% of all the deaths in London are related to dragons, fantastical beings invisible to the majority of the people. While unknown to most, some people have been standing up to these dragons. Only inhabitants of Reverse London w…Серија★8/10Magical Girl Ore"Love makes a girl stronger." Saki Uno is working hard as part of the new idol unit, Magical Twin. The one she admires most is Mohiro Mikage, who’s the older brother of her idol unit partner Sakuyo, and he’s also a member of the top idol un…Серија★8/10