TAப்ளேயர் சர்வர்videasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesAmerican Pastoral20166108 நிமிநாடகம்குற்றம்வெளியீடு20 அக்., 2016நாடுகள்Hong Kong, United States of Americaதயாரிப்புகள்TIK FilmsLakeshore EntertainmentLionsgateSet in postwar America, a man watches his seemingly perfect life fall apart as his daughter's new political affiliation threatens to destroy their family.நடிகர்கள்Ewan McGregorSwede LevovJennifer ConnellyDawn LevovDakota FanningMerry LevovDavid StrathairnNathan ZuckermanPeter RiegertLou LevovRupert EvansJerry LevovUzo AdubaVickyMolly ParkerSheila SmithValorie CurryRita CohenHannah NordbergMerry (12 years old)Julia SilvermanSylvia LevovMark HildrethAgent DolanSimilar vibes20 தலைப்புகள்The OathWhen his daughter's criminal boyfriend becomes an increasing threat to the family, a father must take action to protect them.திரைப்படம்★6/10Silvio ForeverLawsuit-proof satirical "unauthorized biography" of Silvio Berlusconi told using only words spoken by the man himself in interviews, rallies, or other public statements.திரைப்படம்★6/10The Good CatholicAn idealistic young priest is dedicated to his calling until he meets a woman at confession. After the meeting, he seeks guidance from his fellow priests.திரைப்படம்★5/10Idiot LovePere Lluc is thirty five and is living an unclear period in his life. He finds out that one of his friends has death 5 months ago and to forget the sorrows he goes out and get drunk and he falls in love.திரைப்படம்★5/10Ana ArabiaFilmed in one sequence-shot of 1 hour and 25 minutes, Ana Arabia is a moment in the life of a small community of outcasts, Jews and Arabs, who live together in a forgotten enclave at the “border” between Jaffa and Bat Yam, in Israel. One da…திரைப்படம்★6/10The Night My Mother Killed My FatherIsabel is torn between the need to feel valued as an actress and her insecurities and contradictions. One night, she hosts a very special dinner: her husband Ángel, who is a scriptwriter, and Susana, Ángel's ex-wife and film director, want …திரைப்படம்★6/10Nico, 1988Approaching age 50, singer/songwriter Nico leads a solitary existence, far from her days as a Warhol superstar and celebrated vocalist for the Velvet Underground in the 1960s. Her life and career on the fringes, Nico's new manager convinces…திரைப்படம்★7/10Feminists: What Were They Thinking?In 1977, a book of photographs captured an awakening - women shedding the cultural restrictions of their childhoods and embracing their full humanity. This documentary revisits those photos, those women and those times and takes aim at our …திரைப்படம்★7/10Cassandra's DreamThe tale of two brothers with serious financial woes. When a third party proposes they turn to crime, things go bad and the two become enemies.திரைப்படம்★6/10Jadeஒரு முக்கிய கலை வியாபாரி கொலை செய்யப்பட்டு கண்டுபிடிக்கப்படும்போது, அந்த மனிதனின் மரணம் பாலினம், ஊழல் மற்றும் குற்றங்களில் மூழ்கிய ஒரு புதிரான விசாரணைக்கு வழிவகுக்கிறது. மாவட்ட வழக்கறிஞர் டேவிட் கொரெல்லி இந்த வழக்கில் நியமிக்கப்படுகிறார், ம…திரைப்படம்★6/10A Quiet PassionThe story of American poet Emily Dickinson from her early days as a young schoolgirl to her later years as a reclusive, unrecognized artist.திரைப்படம்★6/10Capri-RevolutionIn 1914, with Italy on the cusp of joining World War I, a group of foreign artists establishes a commune on the rural island of Capri, catching the attention of young Lucia, a local illiterate shepherdess who soon falls under their spell.திரைப்படம்★6/107 Minutesதோல்வியடைந்து வரும் பட்டுத் தொழிற்சாலையில் உள்ள பெண்கள், தங்கள் வேலைகளைத் தக்க வைத்துக் கொள்வதற்கான வழியைக் கண்டுபிடிக்க போராடுகிறார்கள்.திரைப்படம்★7/10RomanticheA portrait of the flaws and peculiarities of four type of girls living in different districts of Rome.திரைப்படம்★6/10Some Like It VeiledArmand and Leila, students at Science Po, are a young couple. They plan to go to New York to do their internship at the United Nations. But when Mahmoud, Leila's big brother, returns from a long stay in Yemen, which radically transformed hi…திரைப்படம்★6/10The AlpinistMarc-André Leclerc, an exceptional climber, has made solo his religion and ice his homeland. When filmmaker Peter Mortimer begins his film, he places his camera at the base of a British Columbia cliff and waits patiently for the star climbe…திரைப்படம்★8/10CoriolanusCaius Martius, aka Coriolanus, is an arrogant and fearsome general who has built a career on protecting Rome from its enemies. Pushed by his ambitious mother to seek the position of consul, Coriolanus is at odds with the masses and unpopula…திரைப்படம்★6/10My MotherMargherita, a director in the middle of an existential crisis, has to deal with the inevitable and still unacceptable loss of her mother.திரைப்படம்★7/10Certain WomenThree strong-willed women strive to forge their own paths amidst the wide-open plains of the American Northwest: a lawyer forced to subdue a troubled client; a wife and mother whose plans to construct her dream home reveal fissures in her m…திரைப்படம்★6/10GloriaGloria never imagined that an audition for the music producer Sergio Andrade was going to change her life so drastically. King Midas not only brought her to stardom, but also to a dramatic story of love, heartbreak and betrayal. Based on th…திரைப்படம்★7/10