TAப்ளேயர் சர்வர்videasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesThe Stunt Man19807131 நிமிநாடகம்செயல்நகைச்சுவைத்ரில்லர்காதல்வெளியீடு27 ஜூன், 1980நாடுUnited States of Americaதயாரிப்புகள்20th Century FoxMelvin Simon ProductionsA fugitive stumbles onto a movie set just when they need a new stunt man, takes the job as a way to hide out and falls for the leading lady while facing off with his manipulative director.நடிகர்கள்Peter O'TooleEli CrossSteve RailsbackCameronBarbara HersheyNina FranklinAllen GarfieldSamAlex RoccoJakeSharon FarrellDeniseAdam RoarkeRaymond BaileyPhilip BrunsAceCharles BailChuck BartonJohn GarwoodGabeJim HessHenryJohn PearceGarage GuardSimilar vibes20 தலைப்புகள்The GetawayA recently released ex-convict and his loyal wife go on the run after a heist goes wrong.திரைப்படம்★7/10The Driverஓட்டுநர் கொள்ளைகளுக்காக தப்பிக்கும் கார்களை ஓட்டுவதில் நிபுணத்துவம் பெற்றவர். அவரது விதிவிலக்கான திறமை அவரை இன்னும் பிடிபடவிடாமல் தடுத்துள்ளது. காவல்துறையிடமிருந்து மற்றொரு வெற்றிகரமான விமானத்திற்குப் பிறகு, ஒரு தன்னம்பிக்கை துப்பறியும் நிப…திரைப்படம்★7/10Paper ManA coming-of-middle-age comedy that chronicles the unlikely friendship between failed author Richard Dunne and a Long Island teen who teaches him a thing or two about growing up, all under the disapproving eye of his long-suffering wife and …திரைப்படம்★6/10The Ruling ClassWhen the Earl of Gurney dies in a cross-dressing accident, his schizophrenic son, Jack, inherits the Gurney estate. Jack is not the average nobleman; he sings and dances across the estate and thinks he is Jesus reincarnated. Believing that …திரைப்படம்★6/10Happy, Texasதப்பித்த இரண்டு குற்றவாளிகள் டெக்சாஸின் ஹேப்பி கிராமத்திற்குள் நுழைகிறார்கள், அங்கு அவர்கள் அழகுப் போட்டி ஆலோசகர்களாக பணிபுரியும் ஒரு ஓரினச்சேர்க்கை தம்பதியினராக தவறாக கருதப்படுகிறார்கள். அவர்கள் காவல்துறையை வாத்து செய்ய அதனுடன் செல்கிறார்க…திரைப்படம்★6/10The Scenic RouteAn experimental drama that spins the tale of a woman, her sister, and the man who completes the triangle. Told through such fertile sources as grand opera, classical painting, and Victorian melodrama.திரைப்படம்★5/10The Beautician and the BeastA New York City beautician is mistakenly hired as the school teacher for the children of the president of a small Eastern European country.திரைப்படம்★7/10The Right StuffAt the dawn of the Space Race, seven test pilots set out to become the first American astronauts to enter space. However, the road to making history brings momentous challenges.திரைப்படம்★7/10The Human Centipede 2 (Full Sequence)கற்பனையான டாக்டர் ஹெய்டரால் ஈர்க்கப்பட்டு, குழப்பமடைந்த தனிமையான மார்ட்டின் 12 நபர்கள் கொண்ட சென்டிபீட்டை உருவாக்க கனவு காண்கிறார் மற்றும் அவரது நோய்வாய்ப்பட்ட கற்பனையை உணர புறப்படுகிறார்.திரைப்படம்★5/10The PianoWhen an arranged marriage brings Ada and her spirited daughter to the wilderness of nineteenth-century New Zealand, she finds herself locked in a battle of wills with both her controlling husband and a rugged frontiersman to whom she develo…திரைப்படம்★7/10KnowingA teacher opens a time capsule that has been dug up at his son's elementary school; in it are some chilling predictions -- some that have already occurred and others that are about to -- that lead him to believe his family plays a role in t…திரைப்படம்★6/10The Fast and the Furious: Tokyo DriftIn order to avoid a jail sentence, Sean Boswell heads to Tokyo to live with his military father. In a low-rent section of the city, Shaun gets caught up in the underground world of drift racingதிரைப்படம்★7/10இண்டியானா ஜோன்ஸ் மற்றும் நரக ஆலயம்இந்தியாவுக்கு வந்தவுடன், இண்டியானா ஜோன்ஸ் ஒரு நெருக்கடி நிலைமையுள்ள கிராமத்தால் ஒரு மாயக் கல்லை கண்டுபிடிக்கக் கேட்கப்படுகிறார். அவர் ஒப்புக்கொள்கிறார் – மேலும் ஒரு ரகசியக் குலம் பழமையான அரண்மனையின் குகைகளில் பயங்கரமான திட்டத்தை திட்டமிடுகி…திரைப்படம்★7/10District 9முப்பது ஆண்டுகளுக்கு முன்பு, வேற்றுகிரகவாசிகள் பூமிக்கு வந்தனர். வெற்றி பெறவோ அல்லது உதவி செய்யவோ அல்ல, ஆனால் இறந்து கொண்டிருக்கும் கிரகத்திலிருந்து அடைக்கலம் தேடுவதற்காக. டிஸ்ட்ரிக்ட் 9 என்று அழைக்கப்படும் தென்னாப்பிரிக்க பகுதியில் மனிதர்க…திரைப்படம்★8/10Kong: Skull Islandதுரோகமான, ஆதிகால தீவுக்குள் ஆழமாக ஆய்வாளர்களின் குழு நுழைவதால் குரங்குகளின் ராஜாவின் மர்மமான மற்றும் ஆபத்தான வீட்டை ஆராயுங்கள்.திரைப்படம்★7/10Titanic101 வயது கொண்ட Rose DeWitt Bukater, 84 ஆண்டுகளுக்குப் பிறகு, Titanic கப்பலில் அவர் வாழ்ந்த கதையை கூறுகிறார். இளம் Rose, தாய் மற்றும் காதலனுடன் கப்பலில் ஏறுகிறார். அதே நேரத்தில், Jack Dawson மற்றும் Fabrizio De Rossi மூன்றாம் வகுப்பு டிக்கெட…திரைப்படம்★8/10Joker1980களில், ஒரு தோல்வியுற்ற ஸ்டாண்ட்‑அப் காமெடியன் பைத்தியமாகி, Gotham நகரில் குற்றமும் குழப்பமும் நிறைந்த வாழ்க்கைக்கு மாறி, புகழ்பெற்ற சைக்கோபாதிக் குற்றவாளியாக மாறுகிறார்.திரைப்படம்★8/10Oppenheimerஇரண்டாம் உலகப்போரின் போது அணு குண்டை உருவாக்குவதில் J. ராபர்ட் ஓப்பன்ஹைமரின் பங்கை பற்றிய கதை.திரைப்படம்★8/10Shutter Islandஇரண்டாம் உலகப் போரின் வீரராக இருந்த டெடி டேனியல்ஸ், அமெரிக்க மாஷல் ஆனார், குற்றவாளிகளுக்கான மனநல மருத்துவமனையில் ஒரு நோயாளி மறைந்ததை விசாரிக்கிறார், ஆனால் அவரது முயற்சிகள் கவலைக்குரிய காட்சிகளாலும் ஒரு மர்மமான மருத்துவராலும் பாதிக்கப்படுகின…திரைப்படம்★8/10Once Upon a Time... in Hollywoodலாஸ் ஏஞ்சல்ஸ், 1969. தொலைக்காட்சி நட்சத்திரம் ரிக் டால்டன், மேற்கத்திய மொழிகளில் நிபுணத்துவம் பெற்ற ஒரு போராடும் நடிகர், மற்றும் ஸ்டண்ட்மேன் கிளிஃப் பூத், அவரது சிறந்த நண்பர், தொடர்ந்து மாறிவரும் திரைப்படத் துறையில் உயிர்வாழ முயற்சிக்கின்றன…திரைப்படம்★7/10