VIMáy chủ trình phátvideasyvidsrcvidfastvidlinkvidnestmoviesapi111moviesSpree2020693 phútPhim Kinh DịPhim HàiPhim Gây CấnPhim Hình SựPhát hành14 thg 8, 2020Quốc giaUnited States of AmericaSản xuấtDreamCrewForest Hill EntertainmentSpacemaker ProductionsParticular CrowdSuperBloom FilmsDesperate for an online following, a rideshare driver has figured out a deadly plan to go viral and he will stop at nothing to get his five minutes of fame.Diễn viênJoe KeeryKurt KunkleSasheer ZamataJessie AdamsDavid ArquetteKris KunkleA.J. Del CuetoSpree RiderAndy FaulknerSpree RiderHonor LevySpree RiderSara LassnerAngelaLinas PhillipsFrederickJessalyn GilsigAndreaJohn DeLucaMarioCarlos HigueraGas Station CopMarques BufordHomeless HeroSimilar vibes19 tiêu đềMượn XácA British Army doctor comes back from a war, thinking that she has PTSD only to discover that there is a more daunting malevolence at work making the life that she knew unfamiliar.Phim★6/10DonnybrookAn ex-marine who struggles to provide for his family and a violent drug dealer with an undefeated fighting record are determined to compete in the Donnybrook, a legendary, bare-knuckle brawl with a cash prize of $100,000.Phim★5/10AfterschoolA prep-school student accidentally films the drug-related deaths of two classmates, then is asked to put together a memorial video.Phim★5/10Making Waves: The Art of Cinematic SoundThe history of cinematic sound, told by legendary sound designers and visionary filmmakers.Phim★7/10RetakeA lonely, middle-aged man hires a male prostitute to recreate a road trip from his past.Phim★6/10Possibly in MichiganA musical horror story about two young women who are stalked through a shopping mall by a cannibal. He follows them home, and here the victims become the aggressors.Phim★8/10OgroffOgroff, an AWOL-solider-turned-hermit, lives in the French backwoods, and, still believing war to be raging, slaughters anyone who enters them. One day, a family's car breaks down in Ogroff's domain and a fight for their lives begins.Phim★5/10Extraordinary StoriesX arrives in a small town and witnesses a violent act; Z takes the job of a dead manager and discovers that he had a notebook written in code and a map; H is hired to go down a river and investigate a series of mysterious monoliths built on…Phim★8/10Fulano de TalPhim★0/10The Killing of Two LoversIn a rural Utah town, David, a father of four, grapples with his separation from wife Nikki as she pursues a new relationship.Phim★6/10PiercingAfter kissing his wife and baby goodbye for a seemingly normal business trip, Reed checks himself into a hotel room to accomplish something he’s always dreamed of: the perfect murder. As his sinister plans unfold, he soon realizes he might …Phim★6/10File 253In 2013 a psychiatric clinic which served for more than 50 years caring for patients in Mexico City was demolished. A few months before its demolition, four young men came to investigate the clinic, determined to discover the truth about ru…Phim★6/10We're All Going to the World's FairReality and fantasy begin to blur when a teenager, alone in her attic bedroom, immerses herself in a role-playing horror game online.Phim★5/10Sóng Dữ 2Sóng Dữ 2 kể rằng một nơi nào đó ở Hồng Kông xảy ra vụ án đánh bom, chuyên gia gỡ bom về hưu Phan Thừa Phong (Lưu Đức Hoa) bởi vì hôn mê ở hiện trường nên bị cảnh sát hoài nghi có liên quan đến vụ việc. Phan Thừa Phong sau khi tỉnh lại chỉ …Phim★7/10Tales from the Darkside: The MovieA young boy tells three stories of horror to distract a witch who plans to eat him.Phim★6/10Kẻ thù thân cậnSau khi cuộc phục kích khiến đối tác bỏ mạng, gã buôn ma túy Manuel miễn cưỡng bắt tay với người bạn thời thơ ấu Driss – nay đã là cảnh sát – để truy lùng thủ phạm.Phim★6/10ZolaNăm 2015, A'Ziah "Zola" King tweet về hành trình hoang dại liên quan đến một ma cô, anh bạn trai vụng về và các câu lạc bộ thoát y ổn nhất Tampa. Đây là câu chuyện đó.Phim★6/10The Children's HourAn unruly student at a private all-girls boarding school scandalously accuses the two women who run it of having a romantic relationship.Phim★8/10ButchersA family of sadistic butchers lives deep inside the backcountry. From the dead of winter to the dog days of summer, anyone who crosses their path is dead meat.Phim★5/10